Recombinant Human ATP5I protein, GST-tagged
Cat.No. : | ATP5I-986H |
Product Overview : | Human ATP5I full-length ORF ( AAH03679, 1 a.a. - 69 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the e subunit of the Fo complex. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jun 2010] |
Molecular Mass : | 33.33 kDa |
AA Sequence : | MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATP5I ATP synthase, H+ transporting, mitochondrial Fo complex, subunit E [ Homo sapiens ] |
Official Symbol | ATP5I |
Synonyms | ATP5I; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit E; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit e , ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E; ATP synthase subunit e, mitochondrial; ATPase subunit e; ATP synthase e chain, mitochondrial; F1F0-ATP synthase, murine e subunit; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E; ATP5K; MGC12532; |
Gene ID | 521 |
mRNA Refseq | NM_007100 |
Protein Refseq | NP_009031 |
MIM | 601519 |
UniProt ID | P56385 |
◆ Recombinant Proteins | ||
ATP5I-532R | Recombinant Rat ATP5I Protein, His (Fc)-Avi-tagged | +Inquiry |
Atp5i-3716R | Recombinant Rat Atp5i, GST-tagged | +Inquiry |
ATP5I-1456HF | Recombinant Full Length Human ATP5I Protein, GST-tagged | +Inquiry |
ATP5I-3695C | Recombinant Chicken ATP5I | +Inquiry |
ATP5I-876R | Recombinant Rat ATP5I Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP5I-8598HCL | Recombinant Human ATP5I 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP5I Products
Required fields are marked with *
My Review for All ATP5I Products
Required fields are marked with *