Recombinant Human ATP5I protein, GST-tagged

Cat.No. : ATP5I-986H
Product Overview : Human ATP5I full-length ORF ( AAH03679, 1 a.a. - 69 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the e subunit of the Fo complex. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jun 2010]
Molecular Mass : 33.33 kDa
AA Sequence : MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP5I ATP synthase, H+ transporting, mitochondrial Fo complex, subunit E [ Homo sapiens ]
Official Symbol ATP5I
Synonyms ATP5I; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit E; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit e , ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E; ATP synthase subunit e, mitochondrial; ATPase subunit e; ATP synthase e chain, mitochondrial; F1F0-ATP synthase, murine e subunit; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E; ATP5K; MGC12532;
Gene ID 521
mRNA Refseq NM_007100
Protein Refseq NP_009031
MIM 601519
UniProt ID P56385

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP5I Products

Required fields are marked with *

My Review for All ATP5I Products

Required fields are marked with *

0

Inquiry Basket

cartIcon