Recombinant Human ATP5J2 Full Length Transmembrane protein, His-tagged
Cat.No. : | ATP5J2-1298H |
Product Overview : | Recombinant Human ATP5J2 protein(P56134)(1-94aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-94aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 12.4 kDa |
AA Sequence : | MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | ATP5J2 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2 [ Homo sapiens ] |
Official Symbol | ATP5J2 |
Synonyms | ATP5J2; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2 , ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F2; ATP synthase subunit f, mitochondrial; ATP synthase f chain; mitochondrial; ATP5JL; F1Fo ATP synthase complex Fo membrane domain f subunit; F1Fo ATPase; F1Fo ATPase synthase f subunit; F1F0-type ATPase subunit f; F1Fo-ATPase synthase f subunit; ATP synthase f chain, mitochondrial; F1Fo-ATP synthase complex Fo membrane domain f subunit; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2; |
Gene ID | 9551 |
mRNA Refseq | NM_001003713 |
Protein Refseq | NP_001003713 |
UniProt ID | P56134 |
◆ Recombinant Proteins | ||
ATP5J2-1142HF | Recombinant Full Length Human ATP5J2 Protein, GST-tagged | +Inquiry |
RFL16431HF | Recombinant Full Length Human Atp Synthase Subunit F, Mitochondrial(Atp5J2) Protein, His-Tagged | +Inquiry |
ATP5J2-878R | Recombinant Rat ATP5J2 Protein | +Inquiry |
ATP5J2-865M | Recombinant Mouse ATP5J2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP5J2-1298H | Recombinant Human ATP5J2 Full Length Transmembrane protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP5J2-8596HCL | Recombinant Human ATP5J2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP5J2 Products
Required fields are marked with *
My Review for All ATP5J2 Products
Required fields are marked with *
0
Inquiry Basket