Recombinant Human ATP5J2 Full Length Transmembrane protein, His-tagged
| Cat.No. : | ATP5J2-1298H |
| Product Overview : | Recombinant Human ATP5J2 protein(P56134)(1-94aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-94aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 12.4 kDa |
| AA Sequence : | MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | ATP5J2 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2 [ Homo sapiens ] |
| Official Symbol | ATP5J2 |
| Synonyms | ATP5J2; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2 , ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F2; ATP synthase subunit f, mitochondrial; ATP synthase f chain; mitochondrial; ATP5JL; F1Fo ATP synthase complex Fo membrane domain f subunit; F1Fo ATPase; F1Fo ATPase synthase f subunit; F1F0-type ATPase subunit f; F1Fo-ATPase synthase f subunit; ATP synthase f chain, mitochondrial; F1Fo-ATP synthase complex Fo membrane domain f subunit; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2; |
| Gene ID | 9551 |
| mRNA Refseq | NM_001003713 |
| Protein Refseq | NP_001003713 |
| UniProt ID | P56134 |
| ◆ Recombinant Proteins | ||
| RFL14745PF | Recombinant Full Length Pongo Abelii Atp Synthase Subunit F, Mitochondrial(Atp5J2) Protein, His-Tagged | +Inquiry |
| ATP5J2-2140M | Recombinant Mouse ATP5J2 Protein | +Inquiry |
| ATP5J2-243H | Recombinant Human ATP5J2 Protein, GST-His-tagged | +Inquiry |
| ATP5J2-4596C | Recombinant Chicken ATP5J2 | +Inquiry |
| RFL23506MF | Recombinant Full Length Mouse Atp Synthase Subunit F, Mitochondrial(Atp5J2) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP5J2-8596HCL | Recombinant Human ATP5J2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP5J2 Products
Required fields are marked with *
My Review for All ATP5J2 Products
Required fields are marked with *




