Recombinant Human ATP5O, His-tagged
Cat.No. : | ATP5O-27062TH |
Product Overview : | Recombinant full length Human ATP5O with an N terminal His tag; 211 amino acids with tag, Predicted MWt 23.1 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 190 amino acids |
Description : | The protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance. |
Conjugation : | HIS |
Molecular Weight : | 23.100kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 40% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV |
Sequence Similarities : | Belongs to the ATPase delta chain family. |
Gene Name | ATP5O ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit [ Homo sapiens ] |
Official Symbol | ATP5O |
Synonyms | ATP5O; ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit; ATP synthase subunit O, mitochondrial; ATPO; oligomycin sensitivity conferring protein; OSCP; |
Gene ID | 539 |
mRNA Refseq | NM_001697 |
Protein Refseq | NP_001688 |
MIM | 600828 |
Uniprot ID | P48047 |
Chromosome Location | 21q22 |
Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; F-type ATPase, eukaryotes, organism-specific biosystem; Formation of ATP by chemiosmotic coupling, organism-specific biosystem; |
Function | contributes_to ATPase activity; drug binding; hydrogen ion transporting ATP synthase activity, rotational mechanism; protein complex binding; steroid binding; |
◆ Recombinant Proteins | ||
ATP5O-989H | Recombinant Human ATP5O protein, GST-tagged | +Inquiry |
ATP5O-2143M | Recombinant Mouse ATP5O Protein | +Inquiry |
ATP5O-536R | Recombinant Rat ATP5O Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP5O-2571H | Recombinant Human ATP5O protein, GST-tagged | +Inquiry |
ATP5O-1132Z | Recombinant Zebrafish ATP5O | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP5O-8595HCL | Recombinant Human ATP5O 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP5O Products
Required fields are marked with *
My Review for All ATP5O Products
Required fields are marked with *