Recombinant Human ATP5O protein, GST-tagged
| Cat.No. : | ATP5O-2571H |
| Product Overview : | Recombinant Human ATP5O protein(P48047)(24-213aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 24-213aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 47.9 kDa |
| AA Sequence : | FAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | ATP5O ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit [ Homo sapiens ] |
| Official Symbol | ATP5O |
| Synonyms | ATP5O; ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit; ATP synthase subunit O, mitochondrial; ATPO; oligomycin sensitivity conferring protein; OSCP; human ATP synthase OSCP subunit; oligomycin sensitivity conferral protein; |
| Gene ID | 539 |
| mRNA Refseq | NM_001697 |
| Protein Refseq | NP_001688 |
| MIM | 600828 |
| UniProt ID | P48047 |
| ◆ Recombinant Proteins | ||
| ATP5O-536R | Recombinant Rat ATP5O Protein, His (Fc)-Avi-tagged | +Inquiry |
| ATP5O-27062TH | Recombinant Human ATP5O, His-tagged | +Inquiry |
| ATP5O-2143M | Recombinant Mouse ATP5O Protein | +Inquiry |
| ATP5O-1543HF | Recombinant Full Length Human ATP5O Protein, GST-tagged | +Inquiry |
| ATP5O-880R | Recombinant Rat ATP5O Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP5O-8595HCL | Recombinant Human ATP5O 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP5O Products
Required fields are marked with *
My Review for All ATP5O Products
Required fields are marked with *




