Recombinant Human ATP5O protein, GST-tagged
Cat.No. : | ATP5O-2571H |
Product Overview : | Recombinant Human ATP5O protein(P48047)(24-213aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 24-213aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.9 kDa |
AA Sequence : | FAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ATP5O ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit [ Homo sapiens ] |
Official Symbol | ATP5O |
Synonyms | ATP5O; ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit; ATP synthase subunit O, mitochondrial; ATPO; oligomycin sensitivity conferring protein; OSCP; human ATP synthase OSCP subunit; oligomycin sensitivity conferral protein; |
Gene ID | 539 |
mRNA Refseq | NM_001697 |
Protein Refseq | NP_001688 |
MIM | 600828 |
UniProt ID | P48047 |
◆ Recombinant Proteins | ||
ATP5O-1132Z | Recombinant Zebrafish ATP5O | +Inquiry |
ATP5O-462R | Recombinant Rhesus monkey ATP5O Protein, His-tagged | +Inquiry |
ATP5O-868M | Recombinant Mouse ATP5O Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP5O-989H | Recombinant Human ATP5O protein, GST-tagged | +Inquiry |
ATP5O-1543HF | Recombinant Full Length Human ATP5O Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP5O-8595HCL | Recombinant Human ATP5O 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP5O Products
Required fields are marked with *
My Review for All ATP5O Products
Required fields are marked with *