Recombinant Human ATP6AP2 protein, GST-tagged
Cat.No. : | ATP6AP2-993H |
Product Overview : | Human ATP6AP2 full-length ORF ( NP_005756.2, 1 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 65.4 kDa |
AA Sequence : | MAVFVVLLALVAGVLGNEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATP6AP2 ATPase, H+ transporting, lysosomal accessory protein 2 [ Homo sapiens ] |
Official Symbol | ATP6AP2 |
Synonyms | ATP6AP2; ATPase, H+ transporting, lysosomal accessory protein 2; ATP6IP2, ATPase, H+ transporting, lysosomal interacting protein 2; renin receptor; APT6M8 9; ATP6M8 9; M8 9; N14F; V-ATPase M8.9 subunit; renin/prorenin receptor; ER-localized type I transmembrane adaptor; embryonic liver differentiation factor 10; ATPase H(+)-transporting lysosomal-interacting protein 2; ATPase, H+ transporting, lysosomal interacting protein 2; vacuolar ATP synthase membrane sector-associated protein M8-9; vacuolar proton ATP synthase membrane sector associated protein M8-9; ATPase, H+ transporting, lysosomal (vacuolar proton pump) membrane sector associated protein M8-9; M8-9; MRXE; XMRE; HT028; ELDF10; ATP6IP2; MSTP009; APT6M8-9; ATP6M8-9; MGC99577; |
Gene ID | 10159 |
mRNA Refseq | NM_005765 |
Protein Refseq | NP_005756 |
MIM | 300556 |
UniProt ID | O75787 |
◆ Recombinant Proteins | ||
ATP6AP2-1113HF | Recombinant Full Length Human ATP6AP2 Protein, GST-tagged | +Inquiry |
ATP6AP2-2573H | Recombinant Human ATP6AP2 protein, His-SUMO-tagged | +Inquiry |
ATP6AP2-2444H | Recombinant Human ATP6AP2, His-tagged | +Inquiry |
ATP6AP2-292R | Recombinant Rhesus Macaque ATP6AP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP6AP2-1399H | Recombinant Human ATP6AP2 Protein (Asn17-Glu302), His tagged | +Inquiry |
◆ Native Proteins | ||
ATP6AP2-27064TH | Native Human ATP6AP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP6AP2-8591HCL | Recombinant Human ATP6AP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP6AP2 Products
Required fields are marked with *
My Review for All ATP6AP2 Products
Required fields are marked with *
0
Inquiry Basket