Recombinant Human ATP6V0C Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ATP6V0C-4978H
• Product Overview: ATP6V0C MS Standard C13 and N15-labeled recombinant protein (NP_001685) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. This gene encodes the V0 subunit c. Alternative splicing results in transcript variants. Pseudogenes have been identified on chromosomes 6 and 17.
• Molecular Mass: 15.7 kDa
• AA Sequence: MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ATP6V0C ATPase H+ transporting V0 subunit c [ Homo sapiens (human) ]
• Official Symbol: ATP6V0C
• Synonyms: ATP6V0C; ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c; ATP6C, ATP6L, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 16kD, ATPL; V-type proton ATPase 16 kDa proteolipid subunit; VATL; Vma3; V-ATPase 16 kDa proteolipid subunit; vacuolar H+ ATPase proton channel subunit; vacuolar proton pump 16 kDa proteolipid subunit; vacuolar ATP synthase 16 kDa proteolipid subunit; H(+)-transporting two-sector ATPase, 16 kDa subunit; ATPL; VPPC; ATP6C; ATP6L
• Gene ID: 527
• mRNA Refseq: NM_001694
• Protein Refseq: NP_001685
• MIM: 108745
• UniProt ID: P27449