Recombinant Human ATP6V0C protein, GST-tagged

Cat.No. : ATP6V0C-996H
Product Overview : Human ATP6V0C full-length ORF ( NP_001685.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. This gene encodes the V0 subunit c. Alternative splicing results in transcript variants. Pseudogenes have been identified on chromosomes 6 and 17. [provided by RefSeq, Nov 2010]
Molecular Mass : 42.1 kDa
AA Sequence : MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP6V0C ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c [ Homo sapiens ]
Official Symbol ATP6V0C
Synonyms ATP6V0C; ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c; ATP6C, ATP6L, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 16kD , ATPL; V-type proton ATPase 16 kDa proteolipid subunit; VATL; Vma3; V-ATPase 16 kDa proteolipid subunit; vacuolar H+ ATPase proton channel subunit; vacuolar proton pump 16 kDa proteolipid subunit; vacuolar ATP synthase 16 kDa proteolipid subunit; H(+)-transporting two-sector ATPase, 16 kDa subunit; ATPL; VPPC; ATP6C; ATP6L;
Gene ID 527
mRNA Refseq NM_001198569
Protein Refseq NP_001185498
MIM 108745
UniProt ID P27449

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP6V0C Products

Required fields are marked with *

My Review for All ATP6V0C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon