Recombinant Human ATP6V0C protein, GST-tagged
Cat.No. : | ATP6V0C-996H |
Product Overview : | Human ATP6V0C full-length ORF ( NP_001685.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. This gene encodes the V0 subunit c. Alternative splicing results in transcript variants. Pseudogenes have been identified on chromosomes 6 and 17. [provided by RefSeq, Nov 2010] |
Molecular Mass : | 42.1 kDa |
AA Sequence : | MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATP6V0C ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c [ Homo sapiens ] |
Official Symbol | ATP6V0C |
Synonyms | ATP6V0C; ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c; ATP6C, ATP6L, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 16kD , ATPL; V-type proton ATPase 16 kDa proteolipid subunit; VATL; Vma3; V-ATPase 16 kDa proteolipid subunit; vacuolar H+ ATPase proton channel subunit; vacuolar proton pump 16 kDa proteolipid subunit; vacuolar ATP synthase 16 kDa proteolipid subunit; H(+)-transporting two-sector ATPase, 16 kDa subunit; ATPL; VPPC; ATP6C; ATP6L; |
Gene ID | 527 |
mRNA Refseq | NM_001198569 |
Protein Refseq | NP_001185498 |
MIM | 108745 |
UniProt ID | P27449 |
◆ Recombinant Proteins | ||
ATP6V0C-1526HF | Recombinant Full Length Human ATP6V0C Protein, GST-tagged | +Inquiry |
RFL8695RF | Recombinant Full Length Rat V-Type Proton Atpase 16 Kda Proteolipid Subunit(Atp6V0C) Protein, His-Tagged | +Inquiry |
ATP6V0C-4978H | Recombinant Human ATP6V0C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ATP6V0C-886R | Recombinant Rat ATP6V0C Protein | +Inquiry |
ATP6V0C-996H | Recombinant Human ATP6V0C protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP6V0C-8589HCL | Recombinant Human ATP6V0C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP6V0C Products
Required fields are marked with *
My Review for All ATP6V0C Products
Required fields are marked with *