Recombinant Human ATP6V0D1 protein, GST-tagged
| Cat.No. : | ATP6V0D1-1868H |
| Product Overview : | Recombinant Human ATP6V0D1 protein(1-351 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 01, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-351 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ATP6V0D1 ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 [ Homo sapiens ] |
| Official Symbol | ATP6V0D1 |
| Synonyms | ATP6V0D1; ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1; ATP6D, ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D , ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 1 , ATPase, H+ transporting, lysosomal 38kDa, V0 subunit D1; V-type proton ATPase subunit d 1; ATP6DV; P39; VATX; Vma6; VPATPD; V-ATPase, subunit D; V-ATPase subunit d 1; V-ATPase AC39 subunit; 32 kDa accessory protein; vacuolar proton pump subunit d 1; V-ATPase 40 KDa accessory protein; H(+)-transporting two-sector ATPase, subunit D; ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D; VMA6; ATP6D; FLJ43534; |
| Gene ID | 9114 |
| mRNA Refseq | NM_004691 |
| Protein Refseq | NP_004682 |
| MIM | 607028 |
| UniProt ID | P61421 |
| ◆ Recombinant Proteins | ||
| ATP6V0D1-997H | Recombinant Human ATP6V0D1 protein, GST-tagged | +Inquiry |
| ATP6V0D1-5584C | Recombinant Chicken ATP6V0D1 | +Inquiry |
| ATP6V0D1-10021Z | Recombinant Zebrafish ATP6V0D1 | +Inquiry |
| Atp6v0d1-672M | Recombinant Mouse Atp6v0d1 Protein, MYC/DDK-tagged | +Inquiry |
| ATP6V0D1-1868H | Recombinant Human ATP6V0D1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP6V0D1-8588HCL | Recombinant Human ATP6V0D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP6V0D1 Products
Required fields are marked with *
My Review for All ATP6V0D1 Products
Required fields are marked with *
