Recombinant Human ATP6V0D1 protein, GST-tagged

Cat.No. : ATP6V0D1-1868H
Product Overview : Recombinant Human ATP6V0D1 protein(1-351 aa), fused to GST tag, was expressed in E. coli.
Availability November 03, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-351 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ATP6V0D1 ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 [ Homo sapiens ]
Official Symbol ATP6V0D1
Synonyms ATP6V0D1; ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1; ATP6D, ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D , ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 1 , ATPase, H+ transporting, lysosomal 38kDa, V0 subunit D1; V-type proton ATPase subunit d 1; ATP6DV; P39; VATX; Vma6; VPATPD; V-ATPase, subunit D; V-ATPase subunit d 1; V-ATPase AC39 subunit; 32 kDa accessory protein; vacuolar proton pump subunit d 1; V-ATPase 40 KDa accessory protein; H(+)-transporting two-sector ATPase, subunit D; ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D; VMA6; ATP6D; FLJ43534;
Gene ID 9114
mRNA Refseq NM_004691
Protein Refseq NP_004682
MIM 607028
UniProt ID P61421

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP6V0D1 Products

Required fields are marked with *

My Review for All ATP6V0D1 Products

Required fields are marked with *

0
cart-icon
0
compare icon