Recombinant Human ATP6V0E1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ATP6V0E1-2602H
Product Overview : ATP6V0E1 MS Standard C13 and N15-labeled recombinant protein (NP_003936) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is possibly part of the V0 subunit. Since two nontranscribed pseudogenes have been found in dog, it is possible that the localization to chromosome 2 for this gene by radiation hybrid mapping is representing a pseudogene. Genomic mapping puts the chromosomal location on 5q35.3.
Molecular Mass : 9.2 kDa
AA Sequence : MAYHGLTVPLIVMSVFWGFVGFLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKNETIWYLKYHWPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ATP6V0E1 ATPase H+ transporting V0 subunit e1 [ Homo sapiens (human) ]
Official Symbol ATP6V0E1
Synonyms ATP6V0E1; ATPase H+ transporting V0 subunit e1; M9.2; ATP6H; Vma21; Vma21p; ATP6V0E; V-type proton ATPase subunit e 1; ATPase, H+ transporting, lysosomal 9kDa, V0 subunit e1; H(+)-transporting two-sector ATPase, subunit H; V-ATPase 9.2 kDa membrane accessory protein; V-ATPase H subunit; V-ATPase M9.2 subunit; V-ATPase subunit e 1; vacuolar ATP synthase subunit H; vacuolar proton pump H subunit; vacuolar proton pump subunit e 1; vacuolar proton-ATPase subunit M9.2; EC 7.1.2.2
Gene ID 8992
mRNA Refseq NM_003945
Protein Refseq NP_003936
MIM 603931
UniProt ID O15342

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP6V0E1 Products

Required fields are marked with *

My Review for All ATP6V0E1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon