Recombinant Human ATP8B2 protein, GST-tagged

Cat.No. : ATP8B2-1016H
Product Overview : Human ATP8B2 partial ORF ( NP_065185, 729 a.a. - 807 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Molecular Mass : 34.43 kDa
AA Sequence : TEVFIVTGHTVLEVREELRKAREKMMDSSRSVGNGFTYQDKLSSSKLTSVLEAVAGEYALVINGHSLAHALEADMELEF
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP8B2 ATPase phospholipid transporting 8B2 [ Homo sapiens (human) ]
Official Symbol ATP8B2
Synonyms ATP8B2; ATPase phospholipid transporting 8B2; ATPID; phospholipid-transporting ATPase ID; 36/8-9 fusion protein with epitope for anti-lectin antibody; ATPase, aminophospholipid transporter, class I, type 8B, member 2; ATPase, class I, type 8B, member 2; P4-ATPase flippase complex alpha subunit ATP8B2; probable phospholipid-transporting ATPase ID; EC 3.6.3.1
Gene ID 57198
mRNA Refseq NM_001005855
Protein Refseq NP_001005855
MIM 605867
UniProt ID P98198

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP8B2 Products

Required fields are marked with *

My Review for All ATP8B2 Products

Required fields are marked with *

0
cart-icon
0
compare icon