Recombinant Human ATP8B2 protein, GST-tagged
Cat.No. : | ATP8B2-1016H |
Product Overview : | Human ATP8B2 partial ORF ( NP_065185, 729 a.a. - 807 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 34.43 kDa |
AA Sequence : | TEVFIVTGHTVLEVREELRKAREKMMDSSRSVGNGFTYQDKLSSSKLTSVLEAVAGEYALVINGHSLAHALEADMELEF |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATP8B2 ATPase phospholipid transporting 8B2 [ Homo sapiens (human) ] |
Official Symbol | ATP8B2 |
Synonyms | ATP8B2; ATPase phospholipid transporting 8B2; ATPID; phospholipid-transporting ATPase ID; 36/8-9 fusion protein with epitope for anti-lectin antibody; ATPase, aminophospholipid transporter, class I, type 8B, member 2; ATPase, class I, type 8B, member 2; P4-ATPase flippase complex alpha subunit ATP8B2; probable phospholipid-transporting ATPase ID; EC 3.6.3.1 |
Gene ID | 57198 |
mRNA Refseq | NM_001005855 |
Protein Refseq | NP_001005855 |
MIM | 605867 |
UniProt ID | P98198 |
◆ Recombinant Proteins | ||
ATP8B2-3612H | Recombinant Human ATP8B2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ATP8B2-1016H | Recombinant Human ATP8B2 protein, GST-tagged | +Inquiry |
Atp8b2-1778M | Recombinant Mouse Atp8b2 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP8B2 Products
Required fields are marked with *
My Review for All ATP8B2 Products
Required fields are marked with *