Recombinant Human ATP9B protein, GST-tagged
| Cat.No. : | ATP9B-1019H |
| Product Overview : | Human ATP9B full-length ORF ( AAH53561.1, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ATP9B (ATPase Phospholipid Transporting 9B (Putative)) is a Protein Coding gene. Among its related pathways are Ion channel transport and Cardiac conduction. GO annotations related to this gene include nucleotide binding and cation-transporting ATPase activity. An important paralog of this gene is ATP9A. |
| Molecular Mass : | 42.7 kDa |
| AA Sequence : | MPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCDGWKFLCTSCCGWLINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLYEQFKFFLNLYFLVISCSQFVPALKIGYLYTYWAPLMT |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ATP9B ATPase phospholipid transporting 9B (putative) [ Homo sapiens (human) ] |
| Official Symbol | ATP9B |
| Synonyms | ATP9B; ATPase phospholipid transporting 9B (putative); NEO1L; hMMR1; ATPIIB; ATPASEP; HUSSY-20; probable phospholipid-transporting ATPase IIB; ATPase type IV, phospholipid transporting (P-type); ATPase, class II, type 9B; macrophage MHC receptor 1; EC 3.6.3.1 |
| Gene ID | 374868 |
| mRNA Refseq | NM_001306085 |
| Protein Refseq | NP_001293014 |
| MIM | 614446 |
| UniProt ID | O43861 |
| ◆ Recombinant Proteins | ||
| ATP9B-1310HF | Recombinant Full Length Human ATP9B Protein, GST-tagged | +Inquiry |
| ATP9B-1019H | Recombinant Human ATP9B protein, GST-tagged | +Inquiry |
| ATP9B-552R | Recombinant Rat ATP9B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ATP9B-891M | Recombinant Mouse ATP9B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ATP9B-4186Z | Recombinant Zebrafish ATP9B | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP9B Products
Required fields are marked with *
My Review for All ATP9B Products
Required fields are marked with *
