Recombinant Human ATPBD4 protein, GST-tagged

Cat.No. : ATPBD4-1024H
Product Overview : Human ATPBD4 full-length ORF ( NP_542381.1, 1 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DPH6 (Diphthamine Biosynthesis 6) is a Protein Coding gene. Among its related pathways are Metabolism of proteins and Gamma carboxylation, hypusine formation and arylsulfatase activation. GO annotations related to this gene include diphthine-ammonia ligase activity.
Molecular Mass : 56.7 kDa
AA Sequence : MRVAALISGGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDLYAEAMALPLYRRTIRGRSLDTRQVYTKCEGDEVEDLYELLKLVKEKEEVEGISVGAILSDYQRIRVENVCKRLNLQPLAYLWQRNQEDLLREMISSNIQAMIIKVAALGLDPDKHLGKTLDQMEPYLIELSKKYGVHVCGEGGEYETFTLDCPLFKKKIIVDSSEVVIHSADAFAPVAYLRFLELHLEDKVSSVPDNYRTSNYIYNF
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATPBD4 ATP binding domain 4 [ Homo sapiens ]
Official Symbol ATPBD4
Synonyms DPH6; diphthamine biosynthesis 6; ATPBD4; diphthine--ammonia ligase; ATP binding domain 4; ATP-binding domain-containing protein 4; DPH6 homolog; diphthamide synthase; diphthamide synthetase; protein DPH6 homolog; EC 6.3.1.14
Gene ID 89978
mRNA Refseq NM_080650.3
Protein Refseq NP_542381.1
UniProt ID Q7L8W6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATPBD4 Products

Required fields are marked with *

My Review for All ATPBD4 Products

Required fields are marked with *

0
cart-icon