Recombinant Human ATXN10 protein, GST-tagged
Cat.No. : | ATXN10-1030H |
Product Overview : | Human ATXN10 partial ORF ( NP_037368, 1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that may function in neuron survival, neuron differentiation, and neuritogenesis. These roles may be carried out via activation of the mitogen-activated protein kinase cascade. Expansion of an ATTCT repeat from 9-32 copies to 800-4500 copies in an intronic region of this locus has been associated with spinocerebellar ataxia, type 10. Alternatively spliced transcript variants have been described.[provided by RefSeq, Jul 2016] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | MAAPRPPPARLSGVMVPAPIQDLEALRALTALFKEQRNRETAPRTIFQRVLDILKKSSHAVELACRDPSQVENLASSLQLITECFRCLRNACIECSVNQNSIRNLDTIG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATXN10 ataxin 10 [ Homo sapiens ] |
Official Symbol | ATXN10 |
Synonyms | ATXN10; ataxin 10; SCA10, spinocerebellar ataxia 10; ataxin-10; E46L; FLJ37990; brain protein E46 homolog; spinocerebellar ataxia type 10 protein; SCA10; HUMEEP; |
Gene ID | 25814 |
mRNA Refseq | NM_001167621 |
Protein Refseq | NP_001161093 |
MIM | 611150 |
UniProt ID | Q9UBB4 |
◆ Recombinant Proteins | ||
ATXN10-477R | Recombinant Rhesus monkey ATXN10 Protein, His-tagged | +Inquiry |
ATXN10-306R | Recombinant Rhesus Macaque ATXN10 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATXN10-2193M | Recombinant Mouse ATXN10 Protein | +Inquiry |
ATXN10-7957H | Recombinant Human ATXN10 protein, His & T7-tagged | +Inquiry |
ATXN10-557R | Recombinant Rat ATXN10 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATXN10-51HCL | Recombinant Human ATXN10 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATXN10 Products
Required fields are marked with *
My Review for All ATXN10 Products
Required fields are marked with *