Recombinant Human ATXN10 protein, GST-tagged

• Cat.No.: ATXN10-1030H
• Product Overview: Human ATXN10 partial ORF ( NP_037368, 1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein that may function in neuron survival, neuron differentiation, and neuritogenesis. These roles may be carried out via activation of the mitogen-activated protein kinase cascade. Expansion of an ATTCT repeat from 9-32 copies to 800-4500 copies in an intronic region of this locus has been associated with spinocerebellar ataxia, type 10. Alternatively spliced transcript variants have been described.[provided by RefSeq, Jul 2016]
• Molecular Mass: 37.73 kDa
• AA Sequence: MAAPRPPPARLSGVMVPAPIQDLEALRALTALFKEQRNRETAPRTIFQRVLDILKKSSHAVELACRDPSQVENLASSLQLITECFRCLRNACIECSVNQNSIRNLDTIG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATXN10 ataxin 10 [ Homo sapiens ]
• Official Symbol: ATXN10
• Synonyms: ATXN10; ataxin 10; SCA10, spinocerebellar ataxia 10; ataxin-10; E46L; FLJ37990; brain protein E46 homolog; spinocerebellar ataxia type 10 protein; SCA10; HUMEEP
• Gene ID: 25814
• mRNA Refseq: NM_001167621
• Protein Refseq: NP_001161093
• MIM: 611150
• UniProt ID: Q9UBB4