Recombinant Human ATXN10 protein, GST-tagged

Cat.No. : ATXN10-1030H
Product Overview : Human ATXN10 partial ORF ( NP_037368, 1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that may function in neuron survival, neuron differentiation, and neuritogenesis. These roles may be carried out via activation of the mitogen-activated protein kinase cascade. Expansion of an ATTCT repeat from 9-32 copies to 800-4500 copies in an intronic region of this locus has been associated with spinocerebellar ataxia, type 10. Alternatively spliced transcript variants have been described.[provided by RefSeq, Jul 2016]
Molecular Mass : 37.73 kDa
AA Sequence : MAAPRPPPARLSGVMVPAPIQDLEALRALTALFKEQRNRETAPRTIFQRVLDILKKSSHAVELACRDPSQVENLASSLQLITECFRCLRNACIECSVNQNSIRNLDTIG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATXN10 ataxin 10 [ Homo sapiens ]
Official Symbol ATXN10
Synonyms ATXN10; ataxin 10; SCA10, spinocerebellar ataxia 10; ataxin-10; E46L; FLJ37990; brain protein E46 homolog; spinocerebellar ataxia type 10 protein; SCA10; HUMEEP;
Gene ID 25814
mRNA Refseq NM_001167621
Protein Refseq NP_001161093
MIM 611150
UniProt ID Q9UBB4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATXN10 Products

Required fields are marked with *

My Review for All ATXN10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon