Recombinant Human ATXN2 protein(481-775aa), His-tagged
| Cat.No. : | ATXN2-6422H |
| Product Overview : | Recombinant Human ATXN2 protein(Q99700)(481-775aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 481-775aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 37.0 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | REGHSINTRENKYIPPGQRNREVISWGSGRQNSPRMGQPGSGSMPSRSTSHTSDFNPNSGSDQRVVNGGVPWPSPCPSPSSRPPSRYQSGPNSLPPRAATPTRPPSRPPSRPSRPPSHPSAHGSPAPVSTMPKRMSSEGPPRMSPKAQRHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPVARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSIGNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNETSPSF |
| Gene Name | ATXN2 ataxin 2 [ Homo sapiens ] |
| Official Symbol | ATXN2 |
| Synonyms | ATXN2; ataxin 2; SCA2, spinocerebellar ataxia 2 (olivopontocerebellar ataxia 2, autosomal dominant, ataxin 2) , TNRC13; ataxin-2; ATX2; trinucleotide repeat containing 13; spinocerebellar ataxia type 2 protein; trinucleotide repeat-containing gene 13 protein; SCA2; TNRC13; FLJ46772; |
| Gene ID | 6311 |
| mRNA Refseq | NM_002973 |
| Protein Refseq | NP_002964 |
| MIM | 601517 |
| UniProt ID | Q99700 |
| ◆ Recombinant Proteins | ||
| ATXN2-1031H | Recombinant Human ATXN2 protein, GST-tagged | +Inquiry |
| ATXN2-156H | Recombinant Human ATXN2 Protein, GST-tagged | +Inquiry |
| ATXN2-10069H | Recombinant Human ATXN2 Protein, Non tagged | +Inquiry |
| ATXN2-01H | Recombinant Human ATXN2 Protein, His-Tagged | +Inquiry |
| ATXN2-10068H | Recombinant Human ATXN2, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATXN2 Products
Required fields are marked with *
My Review for All ATXN2 Products
Required fields are marked with *
