Recombinant Human ATXN3 protein, GST-tagged
Cat.No. : | ATXN3-1032H |
Product Overview : | Human ATXN3 full-length ORF ( NP_001019802.1, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Machado-Joseph disease, also known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein encoded by this gene contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 12-44 to 52-86 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2016] |
Molecular Mass : | 35.4 kDa |
AA Sequence : | MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATXN3 ataxin 3 [ Homo sapiens ] |
Official Symbol | ATXN3 |
Synonyms | ATXN3; ataxin 3; Machado Joseph disease (spinocerebellar ataxia 3, olivopontocerebellar ataxia 3, autosomal dominant, ataxin 3) , MJD, SCA3; ataxin-3; ATX3; JOS; josephin; ataxin 3 variant h; ataxin 3 variant m; ataxin 3 variant ref; olivopontocerebellar ataxia 3; Machado-Joseph disease protein 1; spinocerebellar ataxia type 3 protein; Machado-Joseph disease (spinocerebellar ataxia 3, olivopontocerebellar ataxia 3, autosomal dominant, ataxin 3); AT3; MJD; MJD1; SCA3; |
Gene ID | 4287 |
mRNA Refseq | NM_001127696 |
Protein Refseq | NP_001121168 |
MIM | 607047 |
UniProt ID | P54252 |
◆ Recombinant Proteins | ||
ATXN3-0367H | Recombinant Human ATXN3 Protein (E2-K361), Tag Free | +Inquiry |
ATXN3-558R | Recombinant Rat ATXN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Atxn3-478M | Recombinant Mouse Atxn3 Protein, MYC/DDK-tagged | +Inquiry |
ATXN3-1053HF | Recombinant Full Length Human ATXN3 Protein, GST-tagged | +Inquiry |
ATXN3-11326Z | Recombinant Zebrafish ATXN3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATXN3-52HCL | Recombinant Human ATXN3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATXN3 Products
Required fields are marked with *
My Review for All ATXN3 Products
Required fields are marked with *