Recombinant Human ATXN7L4 protein, GST-tagged
Cat.No. : | ATXN7L4-1034H |
Product Overview : | Human ATXN7L4 full-length ORF ( NP_689962.1, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ATXN7L1 (Ataxin 7 Like 1) is a Protein Coding gene. An important paralog of this gene is ATXN7. |
Molecular Mass : | 42.6 kDa |
AA Sequence : | MTSERSRIPCLSAAAAEGTGKKQQEGRAMATLDRKVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKEDMHLFGHYPAHDDFYLVVCSACNQVVKPQVFQSHCGRKQDNRRNEGISRSGPESSQAIEKHQV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATXN7L1 ataxin 7 like 1 [ Homo sapiens (human) ] |
Official Symbol | ATXN7L1 |
Synonyms | ATXN7L1; ataxin 7 like 1; ATXN7L4; ataxin-7-like protein 1; ataxin 7-like 4; ataxin-7-like protein 4 |
Gene ID | 222255 |
mRNA Refseq | NM_001318229 |
Protein Refseq | NP_001305158 |
UniProt ID | Q9ULK2 |
◆ Recombinant Proteins | ||
ATXN7L1-10071H | Recombinant Human ATXN7L1, His-tagged | +Inquiry |
ATXN7L4-1034H | Recombinant Human ATXN7L4 protein, GST-tagged | +Inquiry |
ATXN7L1-1428HF | Recombinant Full Length Human ATXN7L1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATXN7L1-151HCL | Recombinant Human ATXN7L1 cell lysate | +Inquiry |
ATXN7L1-8565HCL | Recombinant Human ATXN7L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATXN7L1 Products
Required fields are marked with *
My Review for All ATXN7L1 Products
Required fields are marked with *