Recombinant Human AUTS2 protein, GST-tagged

Cat.No. : AUTS2-1040H
Product Overview : Human AUTS2 partial ORF ( NP_056385, 108 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene has been implicated in neurodevelopment and as a candidate gene for numerous neurological disorders, including autism spectrum disorders, intellectual disability, and developmental delay. Mutations in this gene have also been associated with non-neurological disorders, such as acute lymphoblastic leukemia, aging of the skin, early-onset androgenetic alopecia, and certain cancers. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2014]
Molecular Mass : 35.75 kDa
AA Sequence : LKPQERVEKRQTPLTKKKREALTNGLSFHSKKSRLSHPHHYSSDRENDRNLCQHLGKRKKMPKALRQLKPGQNSCRDSDSESASGESKGFH
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AUTS2 autism susceptibility candidate 2 [ Homo sapiens ]
Official Symbol AUTS2
Synonyms AUTS2; autism susceptibility candidate 2; autism susceptibility gene 2 protein; FBRSL2; KIAA0442; autism-related protein 1; MGC13140;
Gene ID 26053
mRNA Refseq NM_001127231
Protein Refseq NP_001120703
MIM 607270
UniProt ID Q8WXX7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AUTS2 Products

Required fields are marked with *

My Review for All AUTS2 Products

Required fields are marked with *

0
cart-icon