Recombinant Human AVPR1A protein, GST-tagged

Cat.No. : AVPR1A-1045H
Product Overview : Human AVPR1A partial ORF ( NP_000697, 1 a.a. - 52 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1B, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosphatidylinositol-calcium second messenger system. The receptor mediates cell contraction and proliferation, platelet aggregation, release of coagulation factor and glycogenolysis. [provided by RefSeq, Jul 2008]
Molecular Mass : 31.46 kDa
AA Sequence : MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAK
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AVPR1A arginine vasopressin receptor 1A [ Homo sapiens ]
Official Symbol AVPR1A
Synonyms AVPR1A; arginine vasopressin receptor 1A; AVPR1; vasopressin V1a receptor; V1aR; AVPR V1a; V1a vasopressin receptor; antidiuretic hormone receptor 1A; SCCL vasopressin subtype 1a receptor; V1-vascular vasopressin receptor AVPR1A; vascular/hepatic-type arginine vasopressin receptor;
Gene ID 552
mRNA Refseq NM_000706
Protein Refseq NP_000697
MIM 600821
UniProt ID P37288

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AVPR1A Products

Required fields are marked with *

My Review for All AVPR1A Products

Required fields are marked with *

0
cart-icon