Recombinant Human AVPR1A protein, GST-tagged

• Cat.No.: AVPR1A-1045H
• Product Overview: Human AVPR1A partial ORF ( NP_000697, 1 a.a. - 52 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1B, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosphatidylinositol-calcium second messenger system. The receptor mediates cell contraction and proliferation, platelet aggregation, release of coagulation factor and glycogenolysis. [provided by RefSeq, Jul 2008]
• Molecular Mass: 31.46 kDa
• AA Sequence: MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AVPR1A arginine vasopressin receptor 1A [ Homo sapiens ]
• Official Symbol: AVPR1A
• Synonyms: AVPR1A; arginine vasopressin receptor 1A; AVPR1; vasopressin V1a receptor; V1aR; AVPR V1a; V1a vasopressin receptor; antidiuretic hormone receptor 1A; SCCL vasopressin subtype 1a receptor; V1-vascular vasopressin receptor AVPR1A; vascular/hepatic-type arginine vasopressin receptor
• Gene ID: 552
• mRNA Refseq: NM_000706
• Protein Refseq: NP_000697
• MIM: 600821
• UniProt ID: P37288