Recombinant Human AVPR1A protein, GST-tagged
Cat.No. : | AVPR1A-1045H |
Product Overview : | Human AVPR1A partial ORF ( NP_000697, 1 a.a. - 52 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1B, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosphatidylinositol-calcium second messenger system. The receptor mediates cell contraction and proliferation, platelet aggregation, release of coagulation factor and glycogenolysis. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 31.46 kDa |
AA Sequence : | MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AVPR1A arginine vasopressin receptor 1A [ Homo sapiens ] |
Official Symbol | AVPR1A |
Synonyms | AVPR1A; arginine vasopressin receptor 1A; AVPR1; vasopressin V1a receptor; V1aR; AVPR V1a; V1a vasopressin receptor; antidiuretic hormone receptor 1A; SCCL vasopressin subtype 1a receptor; V1-vascular vasopressin receptor AVPR1A; vascular/hepatic-type arginine vasopressin receptor; |
Gene ID | 552 |
mRNA Refseq | NM_000706 |
Protein Refseq | NP_000697 |
MIM | 600821 |
UniProt ID | P37288 |
◆ Recombinant Proteins | ||
AVPR1A-906R | Recombinant Rat AVPR1A Protein | +Inquiry |
AVPR1A-1285R | Recombinant Rat AVPR1A Protein (7-52 aa), GST-tagged | +Inquiry |
RFL24340MF | Recombinant Full Length Microtus Montanus Vasopressin V1A Receptor(Avpr1A) Protein, His-Tagged | +Inquiry |
RFL9022OF | Recombinant Full Length Sheep Vasopressin V1A Receptor(Avpr1A) Protein, His-Tagged | +Inquiry |
AVPR1A-562R | Recombinant Rat AVPR1A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AVPR1A-152HCL | Recombinant Human AVPR1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AVPR1A Products
Required fields are marked with *
My Review for All AVPR1A Products
Required fields are marked with *
0
Inquiry Basket