Recombinant Human AVPR1A protein, GST-tagged
| Cat.No. : | AVPR1A-1045H |
| Product Overview : | Human AVPR1A partial ORF ( NP_000697, 1 a.a. - 52 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1B, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosphatidylinositol-calcium second messenger system. The receptor mediates cell contraction and proliferation, platelet aggregation, release of coagulation factor and glycogenolysis. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 31.46 kDa |
| AA Sequence : | MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAK |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AVPR1A arginine vasopressin receptor 1A [ Homo sapiens ] |
| Official Symbol | AVPR1A |
| Synonyms | AVPR1A; arginine vasopressin receptor 1A; AVPR1; vasopressin V1a receptor; V1aR; AVPR V1a; V1a vasopressin receptor; antidiuretic hormone receptor 1A; SCCL vasopressin subtype 1a receptor; V1-vascular vasopressin receptor AVPR1A; vascular/hepatic-type arginine vasopressin receptor; |
| Gene ID | 552 |
| mRNA Refseq | NM_000706 |
| Protein Refseq | NP_000697 |
| MIM | 600821 |
| UniProt ID | P37288 |
| ◆ Cell & Tissue Lysates | ||
| AVPR1A-152HCL | Recombinant Human AVPR1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AVPR1A Products
Required fields are marked with *
My Review for All AVPR1A Products
Required fields are marked with *



