Recombinant Human AVPR1B Full Length Transmembrane protein, His-tagged
Cat.No. : | AVPR1B-1024H |
Product Overview : | Recombinant Human AVPR1B protein(P47901)(1-424aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-424aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 53.0 kDa |
AA Sequence : | MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSVQMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQPRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAETIIF |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | AVPR1B arginine vasopressin receptor 1B [ Homo sapiens ] |
Official Symbol | AVPR1B |
Synonyms | AVPR1B; arginine vasopressin receptor 1B; AVPR3; vasopressin V1b receptor; V1bR; AVPR V3; AVPR V1b; vasopressin V3 receptor; arginine vasopressin receptor 3; antidiuretic hormone receptor 1B; pituitary vasopressin receptor 3; |
Gene ID | 553 |
mRNA Refseq | NM_000707 |
Protein Refseq | NP_000698 |
MIM | 600264 |
UniProt ID | P47901 |
◆ Recombinant Proteins | ||
AVPR1B-914M | Recombinant Mouse AVPR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
AVPR1B-312R | Recombinant Rhesus Macaque AVPR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
AVPR1B-2216M | Recombinant Mouse AVPR1B Protein | +Inquiry |
AVPR1B-81C | Recombinant Cynomolgus Monkey AVPR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL19031MF | Recombinant Full Length Mouse Vasopressin V1B Receptor(Avpr1B) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AVPR1B Products
Required fields are marked with *
My Review for All AVPR1B Products
Required fields are marked with *