Recombinant Human AVPR1B Full Length Transmembrane protein, His-tagged

Cat.No. : AVPR1B-1024H
Product Overview : Recombinant Human AVPR1B protein(P47901)(1-424aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-424aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 53.0 kDa
AA Sequence : MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSVQMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQPRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAETIIF
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name AVPR1B arginine vasopressin receptor 1B [ Homo sapiens ]
Official Symbol AVPR1B
Synonyms AVPR1B; arginine vasopressin receptor 1B; AVPR3; vasopressin V1b receptor; V1bR; AVPR V3; AVPR V1b; vasopressin V3 receptor; arginine vasopressin receptor 3; antidiuretic hormone receptor 1B; pituitary vasopressin receptor 3;
Gene ID 553
mRNA Refseq NM_000707
Protein Refseq NP_000698
MIM 600264
UniProt ID P47901

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AVPR1B Products

Required fields are marked with *

My Review for All AVPR1B Products

Required fields are marked with *

0
cart-icon