Recombinant Human AVPR1B protein
Cat.No. : | AVPR1B-1046H |
Product Overview : | Human AVPR1B full-length ORF (AAI56079.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1A, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosphatidylinositol-calcium second messenger system. The receptor is primarily located in the anterior pituitary, where it stimulates ACTH release. It is expressed at high levels in ACTH-secreting pituitary adenomas as well as in bronchial carcinoids responsible for the ectopic ACTH syndrome. A spliced antisense transcript of this gene has been reported but its function is not known. [provided by RefSeq, Jul 2008] |
Form : | Liquid |
Molecular Mass : | 46.7 kDa |
AA Sequence : | MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSVQMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQPRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAETIIF |
Applications : | Antibody Production; Functional Study; Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | AVPR1B arginine vasopressin receptor 1B [ Homo sapiens ] |
Official Symbol | AVPR1B |
Synonyms | AVPR1B; arginine vasopressin receptor 1B; AVPR3; vasopressin V1b receptor; V1bR; AVPR V3; AVPR V1b; vasopressin V3 receptor; arginine vasopressin receptor 3; antidiuretic hormone receptor 1B; pituitary vasopressin receptor 3; |
Gene ID | 553 |
mRNA Refseq | NM_000707 |
Protein Refseq | NP_000698 |
MIM | 600264 |
UniProt ID | P47901 |
◆ Recombinant Proteins | ||
AVPR1B-914M | Recombinant Mouse AVPR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
AVPR1B-312R | Recombinant Rhesus Macaque AVPR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
AVPR1B-331C | Recombinant Cynomolgus AVPR1B Protein, His-tagged | +Inquiry |
AVPR1B-483R | Recombinant Rhesus monkey AVPR1B Protein, His-tagged | +Inquiry |
AVPR1B-1024H | Recombinant Human AVPR1B Full Length Transmembrane protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AVPR1B Products
Required fields are marked with *
My Review for All AVPR1B Products
Required fields are marked with *
0
Inquiry Basket