Recombinant Rat AVPR1B Protein (343-425 aa), His-tagged
Cat.No. : | AVPR1B-1286R |
Product Overview : | Recombinant Rat AVPR1B Protein (343-425 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 343-425 aa |
Description : | Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger syst. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 13.0 kDa |
AA Sequence : | NSRLLPRSLSHHACCTGSKPQVHRQLSTSSLTSRRTTLLTHACGSPTLRLSLNLSLRAKPRPAGSLKDLEQVDGEATMETSIF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | Avpr1b arginine vasopressin receptor 1B [ Rattus norvegicus ] |
Official Symbol | AVPR1B |
Synonyms | AVPR1B; V1bR; AVPR V3; AVPR V1b; |
Gene ID | 29462 |
mRNA Refseq | NM_017205 |
Protein Refseq | NP_058901 |
UniProt ID | P48974 |
◆ Recombinant Proteins | ||
AVPR1B-312R | Recombinant Rhesus Macaque AVPR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
AVPR1B-914M | Recombinant Mouse AVPR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
AVPR1B-1286R | Recombinant Rat AVPR1B Protein (343-425 aa), His-tagged | +Inquiry |
AVPR1B-2216M | Recombinant Mouse AVPR1B Protein | +Inquiry |
AVPR1B-81C | Recombinant Cynomolgus Monkey AVPR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AVPR1B Products
Required fields are marked with *
My Review for All AVPR1B Products
Required fields are marked with *
0
Inquiry Basket