Recombinant Rat AVPR1B Protein (343-425 aa), His-tagged
| Cat.No. : | AVPR1B-1286R |
| Product Overview : | Recombinant Rat AVPR1B Protein (343-425 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 343-425 aa |
| Description : | Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger syst. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 13.0 kDa |
| AA Sequence : | NSRLLPRSLSHHACCTGSKPQVHRQLSTSSLTSRRTTLLTHACGSPTLRLSLNLSLRAKPRPAGSLKDLEQVDGEATMETSIF |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | Avpr1b arginine vasopressin receptor 1B [ Rattus norvegicus ] |
| Official Symbol | AVPR1B |
| Synonyms | AVPR1B; V1bR; AVPR V3; AVPR V1b; |
| Gene ID | 29462 |
| mRNA Refseq | NM_017205 |
| Protein Refseq | NP_058901 |
| UniProt ID | P48974 |
| ◆ Recombinant Proteins | ||
| RFL19031MF | Recombinant Full Length Mouse Vasopressin V1B Receptor(Avpr1B) Protein, His-Tagged | +Inquiry |
| AVPR1B-1024H | Recombinant Human AVPR1B Full Length Transmembrane protein, His-tagged | +Inquiry |
| AVPR1B-1545HF | Recombinant Full Length Human AVPR1B Protein | +Inquiry |
| AVPR1B-81C | Recombinant Cynomolgus Monkey AVPR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
| AVPR1B-2216M | Recombinant Mouse AVPR1B Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AVPR1B Products
Required fields are marked with *
My Review for All AVPR1B Products
Required fields are marked with *
