Recombinant Human axin 1 Protein, His tagged
| Cat.No. : | AXIN1-13H |
| Product Overview : | Recombinant Human axin 1 protein (210-410 aa) with His tag was expressed in E. coli. |
| Availability | November 16, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 210-410 aa |
| Description : | This gene encodes a cytoplasmic protein which contains a regulation of G-protein signaling (RGS) domain and a dishevelled and axin (DIX) domain. The encoded protein interacts with adenomatosis polyposis coli, catenin beta-1, glycogen synthase kinase 3 beta, protein phosphate 2, and itself. This protein functions as a negative regulator of the wingless-type MMTV integration site family, member 1 (WNT) signaling pathway and can induce apoptosis. The crystal structure of a portion of this protein, alone and in a complex with other proteins, has been resolved. Mutations in this gene have been associated with hepatocellular carcinoma, hepatoblastomas, ovarian endometriod adenocarcinomas, and medullablastomas. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 24 kDa |
| AA Sequence : | MYTRTGSESPKVCSDQSSGSGTGKGISGYLPTLNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRVSSSRRYSEGREFRYGSWREPVNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESVQVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL. |
| Purity : | > 80 % by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH 7.4, 10 % Glycerol |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | AXIN1 axin 1 [ Homo sapiens (human) ] |
| Official Symbol | AXIN1 |
| Synonyms | AXIN1; axin 1; axin-1; PPP1R49; protein phosphatase 1; regulatory subunit 49; axis inhibitor 1; fused, mouse, homolog of; axis inhibition protein 1; protein phosphatase 1, regulatory subunit 49; AXIN; MGC52315; |
| Gene ID | 8312 |
| mRNA Refseq | NM_003502 |
| Protein Refseq | NP_003493 |
| MIM | 603816 |
| UniProt ID | O15169 |
| ◆ Recombinant Proteins | ||
| AXIN1-6504C | Recombinant Chicken AXIN1 | +Inquiry |
| AXIN1-02H | Recombinant Human AXIN1 Protein, GST-Tagged | +Inquiry |
| AXIN1-10084H | Recombinant Human AXIN1 protein, His-tagged | +Inquiry |
| AXIN1-1818H | Recombinant Human AXIN1 protein, GST-tagged | +Inquiry |
| AXIN1-565R | Recombinant Rat AXIN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AXIN1 Products
Required fields are marked with *
My Review for All AXIN1 Products
Required fields are marked with *
