Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human AXIN1, His-tagged

Cat.No. : AXIN1-26564TH
Product Overview : Recombinant fragment, corresponding to amino acids 663-826 of Human Axin 1 with N terminal His tag; Predicted MWt 20 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a cytoplasmic protein which contains a regulation of G-protein signaling (RGS) domain and a dishevelled and axin (DIX) domain. The encoded protein interacts with adenomatosis polyposis coli, catenin beta-1, glycogen synthase kinase 3 beta, protein phosphate 2, and itself. This protein functions as a negative regulator of the wingless-type MMTV integration site family, member 1 (WNT) signaling pathway and can induce apoptosis. The crystal structure of a portion of this protein, alone and in a complex with other proteins, has been resolved. Mutations in this gene have been associated with hepatocellular carcinoma, hepatoblastomas, ovarian endometriod adenocarcinomas, and medullablastomas. Two transcript variants encoding distinct isoforms have been identified for this gene.
Conjugation : HIS
Source : E. coli
Tissue specificity : Ubiquitously expressed.
Form : Lyophilised:Reconstitute with 86 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPN PLTQLEEARRRLEEEEKRASRAPSKQRTRSQRKVGGGS AQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELL TKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEE KIIGKVEKVD
Sequence Similarities : Contains 1 DIX domain.Contains 1 RGS domain.
Gene Name : AXIN1 axin 1 [ Homo sapiens ]
Official Symbol : AXIN1
Synonyms : AXIN1; axin 1; axin-1; PPP1R49; protein phosphatase 1; regulatory subunit 49;
Gene ID : 8312
mRNA Refseq : NM_003502
Protein Refseq : NP_003493
MIM : 603816
Uniprot ID : O15169
Chromosome Location : 16p13.3
Pathway : Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Beta-catenin phosphorylation cascade, organism-specific biosystem; C-MYC pathway, organism-specific biosystem; Canonical Wnt signaling pathway, organism-specific biosystem;
Function : GTPase activator activity; I-SMAD binding; R-SMAD binding; SMAD binding; armadillo repeat domain binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends