Species : |
Human |
Source : |
E.coli |
Tag : |
His |
Protein Length : |
663-826 a.a. |
Description : |
This gene encodes a cytoplasmic protein which contains a regulation of G-protein signaling (RGS) domain and a dishevelled and axin (DIX) domain. The encoded protein interacts with adenomatosis polyposis coli, catenin beta-1, glycogen synthase kinase 3 beta, protein phosphate 2, and itself. This protein functions as a negative regulator of the wingless-type MMTV integration site family, member 1 (WNT) signaling pathway and can induce apoptosis. The crystal structure of a portion of this protein, alone and in a complex with other proteins, has been resolved. Mutations in this gene have been associated with hepatocellular carcinoma, hepatoblastomas, ovarian endometriod adenocarcinomas, and medullablastomas. Two transcript variants encoding distinct isoforms have been identified for this gene. |
Conjugation : |
HIS |
Tissue specificity : |
Ubiquitously expressed. |
Form : |
Lyophilised:Reconstitute with 86 μl aqua dest. |
Storage buffer : |
Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : |
Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : |
ENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPN PLTQLEEARRRLEEEEKRASRAPSKQRTRSQRKVGGGS AQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELL TKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEE KIIGKVEKVD |
Sequence Similarities : |
Contains 1 DIX domain.Contains 1 RGS domain. |