Recombinant Human B2M protein, GST-tagged

Cat.No. : B2M-002H
Product Overview : Human B2M full-length ORF ( AAH32589, 1 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 38.83 kDa
AA Sequence : MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Figure :

Gene Name : B2M beta-2-microglobulin [ Homo sapiens ]
Official Symbol : B2M
Synonyms : B2M; beta-2-microglobulin; beta-2-microglobin; beta chain of MHC class I molecules;
Gene ID : 567
mRNA Refseq : NM_004048
Protein Refseq : NP_004039
MIM : 109700
UniProt ID : P61769

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.