Recombinant Human B2M Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | B2M-6236H |
| Product Overview : | B2M MS Standard C13 and N15-labeled recombinant protein (NP_004039) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia. |
| Molecular Mass : | 13.71 kDa |
| AA Sequence : | MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | B2M beta-2-microglobulin [ Homo sapiens (human) ] |
| Official Symbol | B2M |
| Synonyms | B2M; beta-2-microglobulin; beta-2-microglobin; beta chain of MHC class I molecules; |
| Gene ID | 567 |
| mRNA Refseq | NM_004048 |
| Protein Refseq | NP_004039 |
| MIM | 109700 |
| UniProt ID | P61769 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B2M Products
Required fields are marked with *
My Review for All B2M Products
Required fields are marked with *



