Recombinant Human B2M Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | B2M-6236H |
Product Overview : | B2M MS Standard C13 and N15-labeled recombinant protein (NP_004039) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia. |
Molecular Mass : | 13.71 kDa |
AA Sequence : | MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | B2M beta-2-microglobulin [ Homo sapiens (human) ] |
Official Symbol | B2M |
Synonyms | B2M; beta-2-microglobulin; beta-2-microglobin; beta chain of MHC class I molecules; |
Gene ID | 567 |
mRNA Refseq | NM_004048 |
Protein Refseq | NP_004039 |
MIM | 109700 |
UniProt ID | P61769 |
◆ Recombinant Proteins | ||
B2M-414H | Recombinant Human B2M Protein, His (Fc)-Avi-tagged | +Inquiry |
B2M-27H | Recombinant Human B2M Protein, C-6His-Avi tagged, Biotinylated | +Inquiry |
B2M-6744H | Recombinant Human B2M protein, hFc-tagged | +Inquiry |
B2M-104H | Recombinant Human B2M Protein, His-tagged | +Inquiry |
B2M-0234H | Recombinant Human B2M Protein (Met1-Met119), C-His-tagged | +Inquiry |
◆ Native Proteins | ||
B2M-13H | Native Human B2M | +Inquiry |
B2M-5366H | Native Human Beta-2-Microglobulin | +Inquiry |
B2M-8046H | Native Human Beta 2 MicroGlobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
B2M-1656MCL | Recombinant Mouse B2M cell lysate | +Inquiry |
B2M-1512CCL | Recombinant Cynomolgus B2M cell lysate | +Inquiry |
B2M-2204HCL | Recombinant Human B2M cell lysate | +Inquiry |
B2M-1550RCL | Recombinant Rat B2M cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B2M Products
Required fields are marked with *
My Review for All B2M Products
Required fields are marked with *
0
Inquiry Basket