Recombinant Human B3GALT1 protein, GST-tagged

Cat.No. : B3GALT1-005H
Product Overview : Human B3GALT1 partial ORF ( NP_066191.1, 59 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. This family encodes type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon. The beta3GalT proteins also contain conserved sequences not found in the beta4GalT or alpha3GalT proteins. The carbohydrate chains synthesized by these enzymes are designated as type 1, whereas beta4GalT enzymes synthesize type 2 carbohydrate chains. The ratio of type 1:type 2 chains changes during embryogenesis. By sequence similarity, the beta3GalT genes fall into at least two groups: beta3GalT4 and 4 other beta3GalT genes (beta3GalT1-3, beta3GalT5). This gene is expressed exclusively in the brain. The encoded protein shows strict donor substrate specificity for UDP-galactose.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.86 kDa
AA Sequence : NPHSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYH
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name B3GALT1 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1 [ Homo sapiens (human) ]
Official Symbol B3GALT1
Synonyms B3GALT1; beta3Gal-T1; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1; beta-1,3-galactosyltransferase 1; beta3GalT1; beta-3-galt1; beta-1,3-GalTase 1; UDP-galactose:beta-N-acetyl-glucosamine-beta-1,3-galactosyltransferase 1; NP_066191.1; EC 2.4.1.179
Gene ID 8708
mRNA Refseq NM_020981
Protein Refseq NP_066191
MIM 603093
UniProt ID Q9Y5Z6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All B3GALT1 Products

Required fields are marked with *

My Review for All B3GALT1 Products

Required fields are marked with *

0
cart-icon