Recombinant Human B3GALT6 protein, GST-tagged
| Cat.No. : | B3GALT6-012H |
| Product Overview : | Human B3GALT6 partial ORF ( NP_542172, 229 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.85 kDa |
| AA Sequence : | RLSRDYLRAWHSEDVSLGAWLAPVDVQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKREVQLRLSYVYDWSAPPSQCCQRREGIP |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | B3GALT6 UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6 [ Homo sapiens ] |
| Official Symbol | B3GALT6 |
| Synonyms | B3GALT6; UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6; UDP Gal:betaGlcNAc beta 1,3 galactosyltransferase, polypeptide 6; beta-1,3-galactosyltransferase 6; beta 1; 3 galactosyltransferase 6; beta3GalT6; GAG GalTII; beta3Gal-T6; beta-1,3-GalTase 6; galactosyltransferase II; galactosylxylosylprotein 3-beta-galactosyltransferase; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 6; |
| Gene ID | 126792 |
| mRNA Refseq | NM_080605 |
| Protein Refseq | NP_542172 |
| UniProt ID | Q96L58 |
| ◆ Recombinant Proteins | ||
| B3GALT6-012H | Recombinant Human B3GALT6 protein, GST-tagged | +Inquiry |
| B3GALT6-4240Z | Recombinant Zebrafish B3GALT6 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B3GALT6 Products
Required fields are marked with *
My Review for All B3GALT6 Products
Required fields are marked with *
