Recombinant Human B3GNT4 protein, GST-tagged
Cat.No. : | B3GNT4-022H |
Product Overview : | Human B3GNT4 partial ORF ( NP_110392, 279 a.a. - 378 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The encoded enzyme is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate. It is a type II transmembrane protein. [provided by RefSeq] |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | GGYVMSRATVRRLQAIMEDAELFPIDDVFVGMCLRRLGLSPMHHAGFKTFGIRRPLDPLDPCLYRGLLLVHRLSPLEMWTMWALVTDEGLKCAAGPIPQR |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | B3GNT4 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 [ Homo sapiens ] |
Official Symbol | B3GNT4 |
Synonyms | B3GNT4; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4; B3GN T4; beta3Gn T4; BGnT-4; beta-1,3-Gn-T4; beta-1,3-N-acetylglucosaminyltransferase 4; beta-1,3-N-acetylglucosaminyltransferase bGn-T4; B3GN-T4; beta3Gn-T4; |
Gene ID | 79369 |
mRNA Refseq | NM_030765 |
Protein Refseq | NP_110392 |
MIM | 605864 |
UniProt ID | Q9C0J1 |
◆ Recombinant Proteins | ||
B3GNT4-10105H | Recombinant Human B3GNT4, His-tagged | +Inquiry |
B3GNT4-022H | Recombinant Human B3GNT4 protein, GST-tagged | +Inquiry |
B3GNT4-2242M | Recombinant Mouse B3GNT4 Protein | +Inquiry |
B3GNT4-931M | Recombinant Mouse B3GNT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B3GNT4 Products
Required fields are marked with *
My Review for All B3GNT4 Products
Required fields are marked with *
0
Inquiry Basket