Recombinant Human B3GNT4 protein, GST-tagged

• Cat.No.: B3GNT4-022H
• Product Overview: Human B3GNT4 partial ORF ( NP_110392, 279 a.a. - 378 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The encoded enzyme is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate. It is a type II transmembrane protein. [provided by RefSeq]
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: GGYVMSRATVRRLQAIMEDAELFPIDDVFVGMCLRRLGLSPMHHAGFKTFGIRRPLDPLDPCLYRGLLLVHRLSPLEMWTMWALVTDEGLKCAAGPIPQR
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: B3GNT4 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 [ Homo sapiens ]
• Official Symbol: B3GNT4
• Synonyms: B3GNT4; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4; B3GN T4; beta3Gn T4; BGnT-4; beta-1,3-Gn-T4; beta-1,3-N-acetylglucosaminyltransferase 4; beta-1,3-N-acetylglucosaminyltransferase bGn-T4; B3GN-T4; beta3Gn-T4
• Gene ID: 79369
• mRNA Refseq: NM_030765
• Protein Refseq: NP_110392
• MIM: 605864
• UniProt ID: Q9C0J1