Recombinant Human B4GALNT2 protein, His-tagged
| Cat.No. : | B4GALNT2-2515H |
| Product Overview : | Recombinant Human B4GALNT2 protein(497-566 aa), fused to His tag, was expressed in E. coli. |
| Availability | September 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 497-566 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | HSEFFIDGLGTLLVGSCPEVIIGHQSRSPVVDSELAALEKTYNTYRSNTLTRVQFKLALHYFKNHLQCAA |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | B4GALNT2 beta-1,4-N-acetyl-galactosaminyl transferase 2 [ Homo sapiens ] |
| Official Symbol | B4GALNT2 |
| Synonyms | B4GALT; GALGT2 |
| Gene ID | 124872 |
| mRNA Refseq | NM_153446.2 |
| Protein Refseq | NP_703147.2 |
| MIM | 111730 |
| UniProt ID | Q8NHY0 |
| ◆ Recombinant Proteins | ||
| B4GALNT2-1690H | Recombinant Human B4GALNT2 protein, His & T7-tagged | +Inquiry |
| B4GALNT2-5606P | Recombinant Pig B4GALNT2 Protein (Met1-Cys471), N-His tagged | +Inquiry |
| B4GALNT2-027H | Recombinant Human B4GALNT2 protein | +Inquiry |
| B4GALNT2-2515H | Recombinant Human B4GALNT2 protein, His-tagged | +Inquiry |
| B4GALNT2-0037H | Recombinant Human B4GALNT2 Protein (Thr324-Ala566), N-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| B4GALNT2-8540HCL | Recombinant Human B4GALNT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B4GALNT2 Products
Required fields are marked with *
My Review for All B4GALNT2 Products
Required fields are marked with *
