Recombinant Human B4GALT2 protein, GST-tagged
Cat.No. : | B4GALT2-029H |
Product Overview : | Human B4GALT2 full-length ORF ( AAH02431, 1 a.a. - 306 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene synthesizes N-acetyllactosamine in glycolipids and glycoproteins. Its substrate specificity is affected by alpha-lactalbumin but it is not expressed in lactating mammary tissue. Two transcript variants encoding the same protein have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 59.40 kDa |
AA Sequence : | MPSTQLLAAAAAAATAPGPTPPPLAPGSLRSPVPCPVPRLPRCHPVLTRHLVLRVHRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKVSRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITVDIGRPPSWPPRG |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | B4GALT2 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 [ Homo sapiens ] |
Official Symbol | B4GALT2 |
Synonyms | B4GALT2; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2; beta-1,4-galactosyltransferase 2; beta4Gal T2; beta-4-GalT2; beta-1,4-GalTase 2; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 2; UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 2; beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 2; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2; B4Gal-T2; B4Gal-T3; beta4Gal-T2; |
Gene ID | 8704 |
mRNA Refseq | NM_001005417 |
Protein Refseq | NP_001005417 |
MIM | 604013 |
UniProt ID | O60909 |
◆ Recombinant Proteins | ||
B4galt2-11HCL | Recombinant Mouse B4galt2 overexpression lysate | +Inquiry |
B4GALT2-1653HF | Recombinant Full Length Human B4GALT2 Protein, GST-tagged | +Inquiry |
B4GALT2-6886Z | Recombinant Zebrafish B4GALT2 | +Inquiry |
B4galt2-1807M | Recombinant Mouse B4galt2 Protein, Myc/DDK-tagged | +Inquiry |
B4GALT2-2528H | Recombinant Human B4GALT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
B4GALT2-8539HCL | Recombinant Human B4GALT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B4GALT2 Products
Required fields are marked with *
My Review for All B4GALT2 Products
Required fields are marked with *