Recombinant Human B4GALT6 protein, GST-tagged
Cat.No. : | B4GALT6-32H |
Product Overview : | Recombinant Human B4GALT6(48 a.a. - 145 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 48-145 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.52 kDa |
AA Sequence : | ARGIMLRENVKTIGHMIRLYTNKNSTLNGTDYPEGNNSSDYLVQTTTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | B4GALT6 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6 [ Homo sapiens ] |
Official Symbol | B4GALT6 |
Synonyms | B4GALT6; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6; beta-1,4-galactosyltransferase 6; beta4GalT VI; UDP Gal:glucosylceramide beta 1; 4 galactosyltransferase; beta4GalT-VI; beta-1,4-GalTase 6; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6; UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6; B4Gal-T6; beta4Gal-T6; |
Gene ID | 9331 |
mRNA Refseq | NM_004775 |
Protein Refseq | NP_004766 |
MIM | 604017 |
UniProt ID | Q9UBX8 |
Chromosome Location | 18q11 |
Pathway | Asparagine N-linked glycosylation, organism-specific biosystem; Lactosylceramide biosynthesis, organism-specific biosystem; Lactosylceramide biosynthesis, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; N-Glycan antennae elongation, organism-specific biosystem; N-glycan antennae elongation in the medial/trans-Golgi, organism-specific biosystem; |
Function | UDP-galactose:glucosylceramide beta-1,4-galactosyltransferase activity; galactosyltransferase activity; metal ion binding; transferase activity, transferring glycosyl groups; |
◆ Recombinant Proteins | ||
B4galt6-21HCL | Recombinant Mouse B4galt6 overexpression lysate | +Inquiry |
B4GALT6-32H | Recombinant Human B4GALT6 protein, GST-tagged | +Inquiry |
B4GALT6-33H | Recombinant Human B4GALT6 protein, GST-tagged | +Inquiry |
B4GALT6-498R | Recombinant Rhesus monkey B4GALT6 Protein, His-tagged | +Inquiry |
B4GALT6-581R | Recombinant Rat B4GALT6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B4GALT6 Products
Required fields are marked with *
My Review for All B4GALT6 Products
Required fields are marked with *