Recombinant Human BACE2, GST-tagged
Cat.No. : | BACE2-578TH |
Product Overview : | Human BACE2 partial ORF (306 a.a. - 395 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an integral membrane glycoprotein that functions as an aspartic protease. The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step in the etiology of Alzheimer''s disease and Down syndrome. The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 35.64 kDa |
AA Sequence : | TTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISIYLRDENSSRSFRITILPQLY IQPMMGAGLNYECYR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BACE2 beta-site APP-cleaving enzyme 2 [ Homo sapiens (human) ] |
Official Symbol | BACE2 |
Synonyms | BACE2; ASP1; BAE2; DRAP; AEPLC; ALP56; ASP21; CDA13; CEAP1; beta-site APP-cleaving enzyme 2; beta-secretase 2; memapsin-1; theta-secretase; aspartyl protease 1; 56 kDa aspartic-like protease; Down syndrome region aspartic protease; transmembrane aspartic proteinase Asp1; membrane-associated aspartic protease 1; beta-site amyloid beta A4 precursor protein-cleaving enzyme 2; EC 3.4.23.45 |
Gene ID | 25825 |
mRNA Refseq | NM_012105 |
Protein Refseq | NP_036237 |
MIM | 605668 |
UniProt ID | Q9Y5Z0 |
Chromosome Location | 21q22.3 |
Pathway | Alzheimer''s disease |
Function | aspartic-type endopeptidase activity |
◆ Recombinant Proteins | ||
Bace2-947M | Recombinant Mouse Bace2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BACE2-579H | Recombinant Human BACE2 protein, MYC/DDK-tagged | +Inquiry |
BACE2-2540H | Recombinant Human BACE2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Bace2-1833R | Recombinant Rat Bace2 protein, His & GST-tagged | +Inquiry |
BACE2-10121H | Recombinant Human BACE2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BACE2-1388MCL | Recombinant Mouse BACE2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BACE2 Products
Required fields are marked with *
My Review for All BACE2 Products
Required fields are marked with *