Recombinant Human BACE2, GST-tagged
| Cat.No. : | BACE2-578TH |
| Product Overview : | Human BACE2 partial ORF (306 a.a. - 395 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes an integral membrane glycoprotein that functions as an aspartic protease. The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step in the etiology of Alzheimer''s disease and Down syndrome. The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 35.64 kDa |
| AA Sequence : | TTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISIYLRDENSSRSFRITILPQLY IQPMMGAGLNYECYR |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BACE2 beta-site APP-cleaving enzyme 2 [ Homo sapiens (human) ] |
| Official Symbol | BACE2 |
| Synonyms | BACE2; ASP1; BAE2; DRAP; AEPLC; ALP56; ASP21; CDA13; CEAP1; beta-site APP-cleaving enzyme 2; beta-secretase 2; memapsin-1; theta-secretase; aspartyl protease 1; 56 kDa aspartic-like protease; Down syndrome region aspartic protease; transmembrane aspartic proteinase Asp1; membrane-associated aspartic protease 1; beta-site amyloid beta A4 precursor protein-cleaving enzyme 2; EC 3.4.23.45 |
| Gene ID | 25825 |
| mRNA Refseq | NM_012105 |
| Protein Refseq | NP_036237 |
| MIM | 605668 |
| UniProt ID | Q9Y5Z0 |
| Chromosome Location | 21q22.3 |
| Pathway | Alzheimer''s disease |
| Function | aspartic-type endopeptidase activity |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BACE2 Products
Required fields are marked with *
My Review for All BACE2 Products
Required fields are marked with *
