Recombinant Human BACH1 Protein, GST-tagged

Cat.No. : BACH1-27427H
Product Overview : Human BACH1 partial ORF ( NP_996749, 396 a.a.-492 a.a.) recombinant protein with GST-tag at N-terminal was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 396-492
Description : This gene encodes a transcription factor that belongs to the cap'n'collar type of basic region leucine zipper factor family (CNC-bZip). The encoded protein contains broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) domains, which is atypical of CNC-bZip family members. These BTB/POZ domains facilitate protein-protein interactions and formation of homo- and/or hetero-oligomers. When this encoded protein forms a heterodimer with MafK, it functions as a repressor of Maf recognition element (MARE) and transcription is repressed. Multiple alternatively spliced transcript variants have been identified for this gene.
Molecular Mass : 36.41 kDa
AA Sequence : HLAKGFWSDICSTDTPCQMQLSPAVAKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BACH1 BTB domain and CNC homolog 1 [ Homo sapiens (human) ]
Official Symbol BACH1
Synonyms BACH1; BTB domain and CNC homolog 1; BACH-1; BTBD24; transcription regulator protein BACH1; BTB and CNC homology 1, basic leucine zipper transcription factor 1; basic region leucine zipper transcriptional regulator BACH1
Gene ID 571
mRNA Refseq NM_206866
Protein Refseq NP_996749
MIM 602751
UniProt ID O14867

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BACH1 Products

Required fields are marked with *

My Review for All BACH1 Products

Required fields are marked with *

0
cart-icon