Recombinant Human BACH1 Protein, GST-tagged
Cat.No. : | BACH1-27427H |
Product Overview : | Human BACH1 partial ORF ( NP_996749, 396 a.a.-492 a.a.) recombinant protein with GST-tag at N-terminal was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 396-492 |
Description : | This gene encodes a transcription factor that belongs to the cap'n'collar type of basic region leucine zipper factor family (CNC-bZip). The encoded protein contains broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) domains, which is atypical of CNC-bZip family members. These BTB/POZ domains facilitate protein-protein interactions and formation of homo- and/or hetero-oligomers. When this encoded protein forms a heterodimer with MafK, it functions as a repressor of Maf recognition element (MARE) and transcription is repressed. Multiple alternatively spliced transcript variants have been identified for this gene. |
Molecular Mass : | 36.41 kDa |
AA Sequence : | HLAKGFWSDICSTDTPCQMQLSPAVAKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BACH1 BTB domain and CNC homolog 1 [ Homo sapiens (human) ] |
Official Symbol | BACH1 |
Synonyms | BACH1; BTB domain and CNC homolog 1; BACH-1; BTBD24; transcription regulator protein BACH1; BTB and CNC homology 1, basic leucine zipper transcription factor 1; basic region leucine zipper transcriptional regulator BACH1 |
Gene ID | 571 |
mRNA Refseq | NM_206866 |
Protein Refseq | NP_996749 |
MIM | 602751 |
UniProt ID | O14867 |
◆ Recombinant Proteins | ||
BACH1-27427H | Recombinant Human BACH1 Protein, GST-tagged | +Inquiry |
BACH1-948M | Recombinant Mouse BACH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BACH1-504R | Recombinant Rhesus monkey BACH1 Protein, His-tagged | +Inquiry |
BACH1-4068H | Recombinant Human BACH1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BACH1-22H | Recombinant Human BACH1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BACH1-8532HCL | Recombinant Human BACH1 293 Cell Lysate | +Inquiry |
BACH1-8531HCL | Recombinant Human BACH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BACH1 Products
Required fields are marked with *
My Review for All BACH1 Products
Required fields are marked with *