Recombinant Human BACH2 protein, GST-tagged
| Cat.No. : | BACH2-3751H |
| Product Overview : | Recombinant Human BACH2 protein(136-235 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 23, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 136-235 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MSEDGLFVCRKDAACQRPHEDCENSAGEEEDEEEETMDSETAKMACPRDQMLPEPISFEAAAIPVAEKEEALLPEPDVPTDTKESSEKDALTQYPRYKKYQ |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | BACH2 BTB domain and CNC homolog 2 [ Homo sapiens (human) ] |
| Official Symbol | BACH2 |
| Synonyms | IMD60; BTBD25 |
| Gene ID | 60468 |
| mRNA Refseq | NM_001170794.2 |
| Protein Refseq | NP_001164265.1 |
| MIM | 605394 |
| UniProt ID | Q9BYV9 |
| ◆ Recombinant Proteins | ||
| Bach2-688M | Recombinant Mouse Bach2 Protein, MYC/DDK-tagged | +Inquiry |
| BACH2-1277H | Recombinant Human BACH2 Protein (S2-T841), Tag Free | +Inquiry |
| BACH2-1766HF | Recombinant Full Length Human BACH2 Protein, GST-tagged | +Inquiry |
| BACH2-3751H | Recombinant Human BACH2 protein, GST-tagged | +Inquiry |
| BACH2-751H | Recombinant Human BACH2 protein(618-770aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BACH2-8530HCL | Recombinant Human BACH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BACH2 Products
Required fields are marked with *
My Review for All BACH2 Products
Required fields are marked with *
