Recombinant Human BACH2 protein, GST-tagged

Cat.No. : BACH2-3751H
Product Overview : Recombinant Human BACH2 protein(136-235 aa), fused to GST tag, was expressed in E. coli.
Availability May 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 136-235 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MSEDGLFVCRKDAACQRPHEDCENSAGEEEDEEEETMDSETAKMACPRDQMLPEPISFEAAAIPVAEKEEALLPEPDVPTDTKESSEKDALTQYPRYKKYQ
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name BACH2 BTB domain and CNC homolog 2 [ Homo sapiens (human) ]
Official Symbol BACH2
Synonyms IMD60; BTBD25
Gene ID 60468
mRNA Refseq NM_001170794.2
Protein Refseq NP_001164265.1
MIM 605394
UniProt ID Q9BYV9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BACH2 Products

Required fields are marked with *

My Review for All BACH2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon