Recombinant Human BAG6 protein, His-tagged
Cat.No. : | BAG6-2989H |
Product Overview : | Recombinant Human BAG6 protein(833-982 aa), fused to His tag, was expressed in E. coli. |
Availability | August 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 833-982 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LEFLQEQFNSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTAEEAMSRGP |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | BAG6 BCL2-associated athanogene 6 [ Homo sapiens ] |
Official Symbol | BAG6 |
Synonyms | BAG6; BCL2-associated athanogene 6; BAT3, HLA B associated transcript 3; large proline-rich protein BAG6; D6S52E; G3; scythe; protein G3; protein Scythe; HLA-B associated transcript 3; HLA-B associated transcript-3; HLA-B-associated transcript 3; large proline-rich protein BAT3; BAG family molecular chaperone regulator 6; BAT3; BAG-6; |
Gene ID | 7917 |
mRNA Refseq | NM_001098534 |
Protein Refseq | NP_001092004 |
MIM | 142590 |
UniProt ID | P46379 |
◆ Recombinant Proteins | ||
Bag6-294M | Recombinant Mouse Bag6 Protein, His&GST-tagged | +Inquiry |
BAG6-085H | Recombinant Human BAG6 protein, GST-tagged | +Inquiry |
BAG6-2593H | Recombinant Human BAG6 Protein (1-321 aa), His-Myc-tagged | +Inquiry |
BAG6-1832HF | Recombinant Full Length Human BAG6 Protein, GST-tagged | +Inquiry |
BAG6-2353H | Recombinant Human BAG6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAG6-8511HCL | Recombinant Human BAT3 293 Cell Lysate | +Inquiry |
BAG6-8509HCL | Recombinant Human BAT3 293 Cell Lysate | +Inquiry |
BAG6-8510HCL | Recombinant Human BAT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAG6 Products
Required fields are marked with *
My Review for All BAG6 Products
Required fields are marked with *