Recombinant Human BAG6 protein, His-tagged
| Cat.No. : | BAG6-2989H |
| Product Overview : | Recombinant Human BAG6 protein(833-982 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 833-982 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LEFLQEQFNSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTAEEAMSRGP |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | BAG6 BCL2-associated athanogene 6 [ Homo sapiens ] |
| Official Symbol | BAG6 |
| Synonyms | BAG6; BCL2-associated athanogene 6; BAT3, HLA B associated transcript 3; large proline-rich protein BAG6; D6S52E; G3; scythe; protein G3; protein Scythe; HLA-B associated transcript 3; HLA-B associated transcript-3; HLA-B-associated transcript 3; large proline-rich protein BAT3; BAG family molecular chaperone regulator 6; BAT3; BAG-6; |
| Gene ID | 7917 |
| mRNA Refseq | NM_001098534 |
| Protein Refseq | NP_001092004 |
| MIM | 142590 |
| UniProt ID | P46379 |
| ◆ Recombinant Proteins | ||
| BAG6-5105H | Recombinant Human BAG6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Bag6-1820M | Recombinant Mouse Bag6 Protein, Myc/DDK-tagged | +Inquiry |
| BAG6-085H | Recombinant Human BAG6 protein, GST-tagged | +Inquiry |
| BAG6-298H | Recombinant Human BAG6 Protein, His-tagged | +Inquiry |
| BAG6-2353H | Recombinant Human BAG6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BAG6-8511HCL | Recombinant Human BAT3 293 Cell Lysate | +Inquiry |
| BAG6-8510HCL | Recombinant Human BAT3 293 Cell Lysate | +Inquiry |
| BAG6-8509HCL | Recombinant Human BAT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAG6 Products
Required fields are marked with *
My Review for All BAG6 Products
Required fields are marked with *
