Recombinant Human BAI2 protein, GST-tagged
| Cat.No. : | BAI2-060H |
| Product Overview : | Human BAI2 partial ORF ( NP_001694, 22 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | BAI1, a p53-target gene, encodes brain-specific angiogenesis inhibitor, a seven-span transmembrane protein and is thought to be a member of the secretin receptor family. Brain-specific angiogenesis proteins BAI2 and BAI3 are similar to BAI1 in structure, have similar tissue specificities and may also play a role in angiogenesis. [provided by RefSeq |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 35.31 kDa |
| AA Sequence : | DPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLENPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQ |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BAI2 brain-specific angiogenesis inhibitor 2 [ Homo sapiens ] |
| Official Symbol | BAI2 |
| Synonyms | BAI2; brain-specific angiogenesis inhibitor 2; Brain-specific angiongenesis inhibitor-2; |
| Gene ID | 576 |
| mRNA Refseq | NM_001703 |
| Protein Refseq | NP_001694 |
| MIM | 602683 |
| UniProt ID | O60241 |
| ◆ Recombinant Proteins | ||
| BAI2-2279M | Recombinant Mouse BAI2 Protein | +Inquiry |
| BAI2-060H | Recombinant Human BAI2 protein, GST-tagged | +Inquiry |
| BAI2-190H | Active Recombinant Human BAI2 protein, Fc-tagged | +Inquiry |
| BAI2-956M | Recombinant Mouse BAI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAI2 Products
Required fields are marked with *
My Review for All BAI2 Products
Required fields are marked with *



