Recombinant Human BAI2 protein, GST-tagged

• Cat.No.: BAI2-060H
• Product Overview: Human BAI2 partial ORF ( NP_001694, 22 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: BAI1, a p53-target gene, encodes brain-specific angiogenesis inhibitor, a seven-span transmembrane protein and is thought to be a member of the secretin receptor family. Brain-specific angiogenesis proteins BAI2 and BAI3 are similar to BAI1 in structure, have similar tissue specificities and may also play a role in angiogenesis. [provided by RefSeq
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.31 kDa
• AA Sequence: DPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLENPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQ
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BAI2 brain-specific angiogenesis inhibitor 2 [ Homo sapiens ]
• Official Symbol: BAI2
• Synonyms: BAI2; brain-specific angiogenesis inhibitor 2; Brain-specific angiongenesis inhibitor-2
• Gene ID: 576
• mRNA Refseq: NM_001703
• Protein Refseq: NP_001694
• MIM: 602683
• UniProt ID: O60241