Recombinant Human BAI2 protein, GST-tagged

Cat.No. : BAI2-060H
Product Overview : Human BAI2 partial ORF ( NP_001694, 22 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : BAI1, a p53-target gene, encodes brain-specific angiogenesis inhibitor, a seven-span transmembrane protein and is thought to be a member of the secretin receptor family. Brain-specific angiogenesis proteins BAI2 and BAI3 are similar to BAI1 in structure, have similar tissue specificities and may also play a role in angiogenesis. [provided by RefSeq
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.31 kDa
AA Sequence : DPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLENPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQ
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BAI2 brain-specific angiogenesis inhibitor 2 [ Homo sapiens ]
Official Symbol BAI2
Synonyms BAI2; brain-specific angiogenesis inhibitor 2; Brain-specific angiongenesis inhibitor-2;
Gene ID 576
mRNA Refseq NM_001703
Protein Refseq NP_001694
MIM 602683
UniProt ID O60241

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BAI2 Products

Required fields are marked with *

My Review for All BAI2 Products

Required fields are marked with *

0
cart-icon