Recombinant Human BAI3 protein, GST-tagged
| Cat.No. : | BAI3-061H |
| Product Overview : | Human BAI3 partial ORF ( NP_001695, 26 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This p53-target gene encodes a brain-specific angiogenesis inhibitor, a seven-span transmembrane protein, and is thought to be a member of the secretin receptor family. Brain-specific angiogenesis proteins BAI2 and BAI3 are similar to BAI1 in structure, have similar tissue specificities, and may also play a role in angiogenesis. [provided by RefSeq |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | QDFWCSTLVKGVIYGSYSVSEMFPKNFTNCTWTLENPDPTKYSIYLKFSKKDLSCSNFSLLAYQFDHFSHEKIKDLLRKNHSIMQLCNSKNAFVFLQYDKNFIQIRRVFP |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BAI3 brain-specific angiogenesis inhibitor 3 [ Homo sapiens ] |
| Official Symbol | BAI3 |
| Gene ID | 577 |
| mRNA Refseq | NM_001704.2 |
| Protein Refseq | NP_001695.1 |
| MIM | 602684 |
| UniProt ID | O60242 |
| ◆ Recombinant Proteins | ||
| BAI3-061H | Recombinant Human BAI3 protein, GST-tagged | +Inquiry |
| BAI3-7827H | Recombinant Human BAI3, His-tagged | +Inquiry |
| BAI3-10130H | Recombinant Human BAI3, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BAI3-8523HCL | Recombinant Human BAI3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAI3 Products
Required fields are marked with *
My Review for All BAI3 Products
Required fields are marked with *
