Recombinant Human BAIAP2 protein, GST-tagged
Cat.No. : | BAIAP2-062H |
Product Overview : | Human BAIAP2 full-length ORF ( AAH32559, 1 a.a. - 512 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene has been identified as a brain-specific angiogenesis inhibitor (BAI1)-binding protein. This adaptor protein links membrane bound G-proteins to cytoplasmic effector proteins. This protein functions as an insulin receptor tyrosine kinase substrate and suggests a role for insulin in the central nervous system. It also associates with a downstream effector of Rho small G proteins, which is associated with the formation of stress fibers and cytokinesis. This protein is involved in lamellipodia and filopodia formation in motile cells and may affect neuronal growth-cone guidance. This protein has also been identified as interacting with the dentatorubral-pallidoluysian atrophy gene, which is associated with an autosomal dominant neurodegenerative disease. Alternative splicing results in multiple transcript variants encoding distinct isoforms |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 82.06 kDa |
AA Sequence : | MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSR |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BAIAP2 BAI1-associated protein 2 [ Homo sapiens ] |
Official Symbol | BAIAP2 |
Synonyms | BAIAP2; BAI1-associated protein 2; brain-specific angiogenesis inhibitor 1-associated protein 2; BAP2; IRS-58; IRSp53/58; fas ligand-associated factor 3; insulin receptor substrate p53/p58; insulin receptor substrate protein of 53 kDa; FLAF3; IRSP53; |
Gene ID | 10458 |
mRNA Refseq | NM_001144888 |
Protein Refseq | NP_001138360 |
MIM | 605475 |
UniProt ID | Q9UQB8 |
◆ Recombinant Proteins | ||
BAIAP2-12HFL | Recombinant Full Length Human BAIAP2 Protein transcript variant 1, C-Myc/DDK-tagged | +Inquiry |
BAIAP2-593R | Recombinant Rat BAIAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BAIAP2-13HFL | Recombinant Full Length Human BAIAP2 Protein transcript variant 2, C-Myc/DDK-tagged | +Inquiry |
BAIAP2-0439H | Recombinant Human BAIAP2 Protein (Met1-Asn300), N-His-tagged | +Inquiry |
BAIAP2-1806HF | Recombinant Full Length Human BAIAP2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAIAP2-8521HCL | Recombinant Human BAIAP2 293 Cell Lysate | +Inquiry |
BAIAP2-8522HCL | Recombinant Human BAIAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAIAP2 Products
Required fields are marked with *
My Review for All BAIAP2 Products
Required fields are marked with *
0
Inquiry Basket