Recombinant Human BAIAP3 protein, GST-tagged
Cat.No. : | BAIAP3-066H |
Product Overview : | Human BAIAP3 partial ORF ( NP_003924, 302 a.a. - 410 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This p53-target gene encodes a brain-specific angiogenesis inhibitor. The protein is a seven-span transmembrane protein and a member of the secretin receptor family. It interacts with the cytoplasmic region of brain-specific angiogenesis inhibitor 1. This protein also contains two C2 domains, which are often found in proteins involved in signal transduction or membrane trafficking. Its expression pattern and similarity to other proteins suggest that it may be involved in synaptic functions. [provided by RefSeq |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.73 kDa |
AA Sequence : | LVEACRKLNEVIGLKGMGRYFKQIVKSARANGTAGPTEDHTDDFLGCLNIPVREVPVAGVDRWFKLEPRSSASRVQGHCHLVLKLITTQRDTAMSQRGRSGFLSHLLLL |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BAIAP3 BAI1-associated protein 3 [ Homo sapiens ] |
Official Symbol | BAIAP3 |
Synonyms | BAIAP3; BAI1-associated protein 3; BAP3; KIAA0734; BAI-associated protein 3; MGC138334; |
Gene ID | 8938 |
mRNA Refseq | NM_001199096 |
Protein Refseq | NP_001186025 |
MIM | 604009 |
UniProt ID | O94812 |
◆ Recombinant Proteins | ||
BAIAP3-1290H | Recombinant Human BAIAP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BAIAP3-2379H | Recombinant Human BAIAP3 Protein, MYC/DDK-tagged | +Inquiry |
BAIAP3-066H | Recombinant Human BAIAP3 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BAIAP3 Products
Required fields are marked with *
My Review for All BAIAP3 Products
Required fields are marked with *
0
Inquiry Basket