Recombinant Human BAIAP3 protein, GST-tagged

Cat.No. : BAIAP3-066H
Product Overview : Human BAIAP3 partial ORF ( NP_003924, 302 a.a. - 410 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This p53-target gene encodes a brain-specific angiogenesis inhibitor. The protein is a seven-span transmembrane protein and a member of the secretin receptor family. It interacts with the cytoplasmic region of brain-specific angiogenesis inhibitor 1. This protein also contains two C2 domains, which are often found in proteins involved in signal transduction or membrane trafficking. Its expression pattern and similarity to other proteins suggest that it may be involved in synaptic functions. [provided by RefSeq
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.73 kDa
AA Sequence : LVEACRKLNEVIGLKGMGRYFKQIVKSARANGTAGPTEDHTDDFLGCLNIPVREVPVAGVDRWFKLEPRSSASRVQGHCHLVLKLITTQRDTAMSQRGRSGFLSHLLLL
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BAIAP3 BAI1-associated protein 3 [ Homo sapiens ]
Official Symbol BAIAP3
Synonyms BAIAP3; BAI1-associated protein 3; BAP3; KIAA0734; BAI-associated protein 3; MGC138334;
Gene ID 8938
mRNA Refseq NM_001199096
Protein Refseq NP_001186025
MIM 604009
UniProt ID O94812

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BAIAP3 Products

Required fields are marked with *

My Review for All BAIAP3 Products

Required fields are marked with *

0
cart-icon