Recombinant Full Length Human BAK1 Protein, GST tagged
Cat.No. : | BAK1-26166TH |
Product Overview : | Human BAK1 full-length ORF ( NP_001179.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-211 aa |
Description : | The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress. |
Molecular Weight : | 49.8 kDa |
AA Sequence : | MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS |
Quality Control Testing : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BAK1 BCL2 antagonist/killer 1 [ Homo sapiens (human) ] |
Official Symbol | BAK1 |
Synonyms | BAK1; BCL2-antagonist/killer 1; CDN1; bcl-2 homologous antagonist/killer; BAK; BCL2L7; bcl2-L-7; BCL2-like 7 protein; bcl-2-like protein 7; apoptosis regulator BAK; pro-apoptotic protein BAK; BAK-LIKE; MGC3887; MGC117255 |
Gene ID | 578 |
mRNA Refseq | NM_001188 |
Protein Refseq | NP_001179 |
MIM | 600516 |
UniProt ID | Q16611 |
◆ Recombinant Proteins | ||
RFL9990MF | Recombinant Full Length Mouse Bcl-2 Homologous Antagonist/Killer(Bak1) Protein, His-Tagged | +Inquiry |
BAK1-337R | Recombinant Rhesus Macaque BAK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BAK1-36H | Recombinant Human BAK1 protein, His-tagged | +Inquiry |
BAK1-26168TH | Recombinant Human BAK1 | +Inquiry |
BAK1-26166TH | Recombinant Full Length Human BAK1 Protein, GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAK1-8519HCL | Recombinant Human BAK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAK1 Products
Required fields are marked with *
My Review for All BAK1 Products
Required fields are marked with *