Recombinant Human BAP1 Protein, GST-tagged
Cat.No. : | BAP1-13H |
Product Overview : | Recombinant Human BAP1 Protein(18-228 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 18-228 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | LVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRF |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | BAP1 |
Synonyms | BAP1; BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase); ubiquitin carboxyl-terminal hydrolase BAP1; hucep 6; KIAA0272; UCHL2; cerebral protein 6; cerebral protein-13; TPDS; hucep-6; HUCEP-13; FLJ35406; FLJ37180; DKFZp686N04275; |
Gene ID | 8314 |
mRNA Refseq | NM_004656 |
Protein Refseq | NP_004647 |
MIM | 603089 |
UniProt ID | Q92560 |
◆ Recombinant Proteins | ||
BAP1-1599HFL | Recombinant Full Length Human BAP1 Protein, C-Flag-tagged | +Inquiry |
BAP1-597R | Recombinant Rat BAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BaP1-769T | Recombinant Terciopelo BaP1 protein(192-394aa), His&Myc-tagged | +Inquiry |
BAP1-167H | Active Recombinant Human BAP1 protein, His-tagged | +Inquiry |
BAP1-339R | Recombinant Rhesus Macaque BAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAP1-8515HCL | Recombinant Human BAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAP1 Products
Required fields are marked with *
My Review for All BAP1 Products
Required fields are marked with *