Recombinant Human BARX2 protein, GST-tagged

Cat.No. : BARX2-080H
Product Overview : Human BARX2 partial ORF ( NP_003649, 161 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the homeobox transcription factor family. A highly related protein in mouse has been shown to influence cellular processes that control cell adhesion and remodeling of the actin cytoskeleton in myoblast fusion and chondrogenesis. The encoded protein may also play a role in cancer progression. [provided by RefSeq
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : PDRLDLAQSLGLTQLQVKTWYQNRRMKWKKMVLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQGQEQLEPSQGQEELCEAQEPKARDVPLEMAE
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BARX2 BARX homeobox 2 [ Homo sapiens ]
Official Symbol BARX2
Synonyms BARX2; BARX homeobox 2; BarH like homeobox 2; homeobox protein BarH-like 2; BarH-like homeobox 2; MGC133368; MGC133369;
Gene ID 8538
mRNA Refseq NM_003658
Protein Refseq NP_003649
MIM 604823
UniProt ID Q9UMQ3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BARX2 Products

Required fields are marked with *

My Review for All BARX2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon