Recombinant Human BAT1 protein, GST-tagged
| Cat.No. : | BAT1-301601H |
| Product Overview : | Recombinant Human BAT1 (80-428 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Ile80-Arg428 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | ILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | DDX39B DExD-box helicase 39B [ Homo sapiens (human) |
| Official Symbol | BAT1 |
| Synonyms | DDX39B; UAP56; D6S81E |
| Gene ID | 7919 |
| mRNA Refseq | NM_004640 |
| Protein Refseq | NP_004631 |
| MIM | 142560 |
| UniProt ID | Q13838 |
| ◆ Recombinant Proteins | ||
| BAT1-11181Z | Recombinant Zebrafish BAT1 | +Inquiry |
| BAT1-301601H | Recombinant Human BAT1 protein, GST-tagged | +Inquiry |
| BAT1-789H | Recombinant Human HLA-B Associated Transcript 1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAT1 Products
Required fields are marked with *
My Review for All BAT1 Products
Required fields are marked with *
