Recombinant Human BATF2 Protein, GST-tagged
Cat.No. : | BATF2-4344H |
Product Overview : | Human MGC20410 full-length ORF ( AAH12330, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | BATF2 (Basic Leucine Zipper ATF-Like Transcription Factor 2) is a Protein Coding gene. Diseases associated with BATF2 include Cercarial Dermatitis. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and sequence-specific DNA binding. An important paralog of this gene is BATF. |
Molecular Mass : | 46.53 kDa |
AA Sequence : | MDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BATF2 basic leucine zipper transcription factor, ATF-like 2 [ Homo sapiens ] |
Official Symbol | BATF2 |
Synonyms | BATF2; basic leucine zipper transcription factor, ATF-like 2; basic leucine zipper transcriptional factor ATF-like 2; MGC20410; B-ATF-2; suppressor of AP-1 regulated by IFN; SARI; |
Gene ID | 116071 |
mRNA Refseq | NM_138456 |
Protein Refseq | NP_612465 |
UniProt ID | Q8N1L9 |
◆ Recombinant Proteins | ||
BATF2-2373H | Recombinant Human BATF2 Protein, His-tagged | +Inquiry |
BATF2-6155HF | Recombinant Full Length Human BATF2 Protein, GST-tagged | +Inquiry |
BATF2-2298M | Recombinant Mouse BATF2 Protein | +Inquiry |
BATF2-968M | Recombinant Mouse BATF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BATF2-4344H | Recombinant Human BATF2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BATF2-8507HCL | Recombinant Human BATF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BATF2 Products
Required fields are marked with *
My Review for All BATF2 Products
Required fields are marked with *