Recombinant Human BAX Protein, GST-tagged

Cat.No. : BAX-095H
Product Overview : Human BAX partial ORF ( NP_620116, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
Purity : Glutathione Sepharose 4 Fast Flow
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BAX BCL2-associated X protein [ Homo sapiens ]
Official Symbol BAX
Synonyms BAX; BCL2-associated X protein; apoptosis regulator BAX; BCL2L4; bcl2-L-4; bcl-2-like protein 4; BCL2-associated X protein omega;
Gene ID 581
mRNA Refseq NM_004324
Protein Refseq NP_004315
MIM 600040
UniProt ID Q07812

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BAX Products

Required fields are marked with *

My Review for All BAX Products

Required fields are marked with *

0
cart-icon