Recombinant Human BAX Protein, GST-tagged
Cat.No. : | BAX-095H |
Product Overview : | Human BAX partial ORF ( NP_620116, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF |
Purity : | Glutathione Sepharose 4 Fast Flow |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BAX BCL2-associated X protein [ Homo sapiens ] |
Official Symbol | BAX |
Synonyms | BAX; BCL2-associated X protein; apoptosis regulator BAX; BCL2L4; bcl2-L-4; bcl-2-like protein 4; BCL2-associated X protein omega; |
Gene ID | 581 |
mRNA Refseq | NM_004324 |
Protein Refseq | NP_004315 |
MIM | 600040 |
UniProt ID | Q07812 |
◆ Recombinant Proteins | ||
BAX-8493H | Recombinant human BAX protein, GST-tagged | +Inquiry |
BAX-1578HF | Recombinant Full Length Human BAX Protein, GST-tagged | +Inquiry |
BAX-300P | Recombinant Pig BAX Protein, His-tagged | +Inquiry |
BAX-514R | Recombinant Rhesus monkey BAX Protein, His-tagged | +Inquiry |
Bax-1381M | Recombinant Mouse BCL2-associated X Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAX-8506HCL | Recombinant Human BAX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BAX Products
Required fields are marked with *
My Review for All BAX Products
Required fields are marked with *
0
Inquiry Basket