Recombinant human BAX protein, GST-tagged
Cat.No. : | BAX-8493H |
Product Overview : | Recombinant BAX protein, fused to GST-tag, was expressed in E.coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 192 |
Description : | The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8). 5% trehalose and 5% mannitol are added as protectants before lyophilization. |
Molecular Mass : | 37 kDa |
AA Sequence : | MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8 centigrade for (1-2 weeks). Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). |
Gene Name | BAX |
Official Symbol | BAX |
Synonyms | BCL2L4 |
Gene ID | 581 |
mRNA Refseq | NM_138761.4 |
Protein Refseq | NP_620116.1 |
MIM | 600040 |
UniProt ID | Q07812 |
◆ Recombinant Proteins | ||
BAX-0221H | Recombinant Human BAX Protein (Met1-Gln171), C-His-tagged | +Inquiry |
BAX-1216HFL | Recombinant Full Length Human BAX Protein, C-Flag-tagged | +Inquiry |
BAX-6975H | Recombinant Human BAX, GST-tagged | +Inquiry |
BAX-1578HF | Recombinant Full Length Human BAX Protein, GST-tagged | +Inquiry |
BAX-321H | Recombinant Human BCL2-Associated X Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAX-8506HCL | Recombinant Human BAX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAX Products
Required fields are marked with *
My Review for All BAX Products
Required fields are marked with *
0
Inquiry Basket