Recombinant Human BBS1 Protein
| Cat.No. : | BBS1-105H |
| Product Overview : | Human BBS1 partial ORF ( NP_078925, 187 a.a. - 295 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 187-295 a.a. |
| Description : | Mutations in this gene have been observed in patients with the major form (type 1) of Bardet-Biedl syndrome. The encoded protein may play a role in eye, limb, cardiac and reproductive system development. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 37.73 kDa |
| AA Sequence : | NQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGL |
| Purity : | Glutathione Sepharose 4 Fast Flow |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BBS1 Bardet-Biedl syndrome 1 [ Homo sapiens ] |
| Official Symbol | BBS1 |
| Synonyms | BBS1; Bardet-Biedl syndrome 1; Bardet-Biedl syndrome 1 protein; FLJ23590; BBS2-like protein 2; BBS2L2; MGC51114; MGC126183; MGC126184; |
| Gene ID | 582 |
| mRNA Refseq | NM_024649 |
| Protein Refseq | NP_078925 |
| MIM | 209901 |
| UniProt ID | Q8NFJ9 |
| ◆ Recombinant Proteins | ||
| BBS1-5671Z | Recombinant Zebrafish BBS1 | +Inquiry |
| BBS1-104H | Recombinant Human BBS1 Protein | +Inquiry |
| BBS1-1583HF | Recombinant Full Length Human BBS1 Protein | +Inquiry |
| BBS1-02HFL | Recombinant Full Length Human BBS1 Protein, Tag Free | +Inquiry |
| BBS1-01HFL | Recombinant Full Length Human BBS1 Protein, His&SUMO tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BBS1-8504HCL | Recombinant Human BBS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BBS1 Products
Required fields are marked with *
My Review for All BBS1 Products
Required fields are marked with *



