Recombinant Human BBS3 protein, GST-tagged
| Cat.No. : | BBS3-301447H |
| Product Overview : | Recombinant Human BBS3 (1-186 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Thr186 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKT |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | ARL6 ADP ribosylation factor like GTPase 6 [ Homo sapiens (human) ] |
| Official Symbol | BBS3 |
| Synonyms | ARL6; RP55 |
| Gene ID | 84100 |
| mRNA Refseq | NM_001278293 |
| Protein Refseq | NP_001265222 |
| MIM | 608845 |
| UniProt ID | ARL6 |
| ◆ Recombinant Proteins | ||
| BBS3-301447H | Recombinant Human BBS3 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BBS3 Products
Required fields are marked with *
My Review for All BBS3 Products
Required fields are marked with *



