Recombinant Human BCAM

Cat.No. : BCAM-27252TH
Product Overview : Recombinant fragment of Human CD239 with N terminal proprietary tag; Predicted MW 36.63 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Lutheran blood group glycoprotein is a member of the immunoglobulin superfamily and a receptor for the extracellular matrix protein, laminin. The protein contains five, N-terminus, extracellular immunoglobulin domains, a single transmembrane domain, and a short, C-terminal cytoplasmic tail. This protein may play a role in epithelial cell cancer and in vaso-occlusion of red blood cells in sickle cell disease. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Wide tissue distribution (highest in the pancreas and very low in brain). Closely associated with the basal layer of cells in epithelia and the endothelium of blood vessel walls.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGA
Sequence Similarities : Contains 3 Ig-like C2-type (immunoglobulin-like) domains.Contains 2 Ig-like V-type (immunoglobulin-like) domains.
Gene Name BCAM basal cell adhesion molecule (Lutheran blood group) [ Homo sapiens ]
Official Symbol BCAM
Synonyms BCAM; basal cell adhesion molecule (Lutheran blood group); basal cell adhesion molecule (Lu and Au blood groups) , LU, Lutheran blood group (Auberger b antigen included); basal cell adhesion molecule; CD239;
Gene ID 4059
mRNA Refseq NM_001013257
Protein Refseq NP_001013275
MIM 612773
Uniprot ID P50895
Chromosome Location 19q12-q13
Function laminin binding; laminin receptor activity; transmembrane signaling receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCAM Products

Required fields are marked with *

My Review for All BCAM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon