Recombinant Human BCAM
Cat.No. : | BCAM-27252TH |
Product Overview : | Recombinant fragment of Human CD239 with N terminal proprietary tag; Predicted MW 36.63 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Lutheran blood group glycoprotein is a member of the immunoglobulin superfamily and a receptor for the extracellular matrix protein, laminin. The protein contains five, N-terminus, extracellular immunoglobulin domains, a single transmembrane domain, and a short, C-terminal cytoplasmic tail. This protein may play a role in epithelial cell cancer and in vaso-occlusion of red blood cells in sickle cell disease. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Wide tissue distribution (highest in the pancreas and very low in brain). Closely associated with the basal layer of cells in epithelia and the endothelium of blood vessel walls. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGA |
Sequence Similarities : | Contains 3 Ig-like C2-type (immunoglobulin-like) domains.Contains 2 Ig-like V-type (immunoglobulin-like) domains. |
Gene Name | BCAM basal cell adhesion molecule (Lutheran blood group) [ Homo sapiens ] |
Official Symbol | BCAM |
Synonyms | BCAM; basal cell adhesion molecule (Lutheran blood group); basal cell adhesion molecule (Lu and Au blood groups) , LU, Lutheran blood group (Auberger b antigen included); basal cell adhesion molecule; CD239; |
Gene ID | 4059 |
mRNA Refseq | NM_001013257 |
Protein Refseq | NP_001013275 |
MIM | 612773 |
Uniprot ID | P50895 |
Chromosome Location | 19q12-q13 |
Function | laminin binding; laminin receptor activity; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
BCAM-1553C | Recombinant Cynomolgus BCAM protein, His-tagged | +Inquiry |
BCAM-2369H | Recombinant Human BCAM Protein, MYC/DDK-tagged | +Inquiry |
BCAM-0734H | Recombinant Human BCAM Protein (Glu32-His257), N-His tagged | +Inquiry |
BCAM-949R | Recombinant Rat BCAM Protein | +Inquiry |
Bcam-7466R | Active Recombinant Rat Bcam protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCAM-1438RCL | Recombinant Rat BCAM cell lysate | +Inquiry |
BCAM-1649HCL | Recombinant Human BCAM cell lysate | +Inquiry |
BCAM-1708MCL | Recombinant Mouse BCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCAM Products
Required fields are marked with *
My Review for All BCAM Products
Required fields are marked with *