Recombinant Human BCAP29 Protein, GST-tagged
Cat.No. : | BCAP29-117H |
Product Overview : | Human BCAP29 partial ORF ( AAH08478, 125 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 38.50 kDa |
AA Sequence : | TQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKRL |
Purity : | Glutathione Sepharose 4 Fast Flow |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCAP29 B-cell receptor-associated protein 29 [ Homo sapiens ] |
Official Symbol | BCAP29 |
Synonyms | BCAP29; B-cell receptor-associated protein 29; BAP29; DKFZp686M2086; BCR-associated protein 29; FLJ53907; |
Gene ID | 55973 |
mRNA Refseq | NM_001008405 |
Protein Refseq | NP_001008405 |
UniProt ID | Q9UHQ4 |
◆ Cell & Tissue Lysates | ||
BCAP29-161HCL | Recombinant Human BCAP29 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCAP29 Products
Required fields are marked with *
My Review for All BCAP29 Products
Required fields are marked with *